Dataset for protein adenoviridae of organism Human adenovirus 11 34

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


W6EIX6_E1B19K-01      --------------MEVWAILEDLRKTR-----QLLEDASDGVSG-----
W6EIX6_E1B19K-02      MDPADSFQQGIRFGFHSHSIVENMEGSQDEDNLRLLASAAFGCSGNPEAS
                                    :  .:*:*::  :.     .** .*: * **     

W6EIX6_E1B19K-01      --------------------------------------------------
W6EIX6_E1B19K-02      TGHASGSGGGTARGQPESRPGPSSGGGGVADLSPELQRVLTGSTSTGRDR
                                                                        

W6EIX6_E1B19K-01      ------------------------------FWR-----------------
W6EIX6_E1B19K-02      GVKRERACSGTDARSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKY
                                                    :*.                 

W6EIX6_E1B19K-01      -------FWFASE---------LARVVFRIKQDYK---------------
W6EIX6_E1B19K-02      SLEQVKTCWLEPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYISG
                              *: .*          *.:.:* .::**               

W6EIX6_E1B19K-01      -------EEFEKLLLDC------PGLFEALNLGH-QVHFKEKVLSVLDFS
W6EIX6_E1B19K-02      NGAEVVIDTPDKTVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVFM
                             :  :* :: *      **:.    : . :*:*. .  . : * 

W6EIX6_E1B19K-01      TPGRT----AAAVAFLTFILDKWIPQTHFSRGYVLDFIATALWRTWKVRK
W6EIX6_E1B19K-02      ANTKLILHGCSFFGFNNTCVDAWGQVSVRGCSFCACWIATAGRTKSQLSL
                      :  .     .: ..* .  :* *   :  . .:   :**** . . ::  

W6EIX6_E1B19K-01      MRTILGY-------------------------------------------
W6EIX6_E1B19K-02      KKCIFQRCNLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGASD
                       . *:                                             

W6EIX6_E1B19K-01      -----------------------------WPV------------------
W6EIX6_E1B19K-02      ERPYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDHNVLTKCTMHAGGRRG
                                                   ***                  

W6EIX6_E1B19K-01      ---------------------QPLGVAGIL--------------------
W6EIX6_E1B19K-02      MFMPYQCNMNHVKVLLEPDAFSRMSLTGIFDMNMQIWKILRYDDTRSRVR
                                           . :.::**:                    

W6EIX6_E1B19K-01      ---------RHPPVMPAVLEEEQQED----NPRAGLDPPVEEAE
W6EIX6_E1B19K-02      ACECGGKHARFQPVCVDVTEDLRPDHLVIARTGAEFGSSGEETD
                               *. **   * *: . :     .. * :... **::

© 1998-2020Legal notice