Dataset for protein Bcl-2 of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

102 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1MZW1_BCL2-01          --------------------------------------------------
A0A3P8YNB4_BCL2-01      ------------------------MADDDNRFIVEKYICHKLLKRGYAWD
A0A3P8WUE9_BCL2-01      ---------------MYLVPNSAGMASECNRYIVEKYICHKLAKRGYVWE
A0A3B4A3G8_BCL2-01      ------------------------MANDCNRNIVEKYICHKLSKRGFAWG
A0A3Q3G1D7_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKRGYEWG
A0A3Q2XQX2_BCL2-02      ------------------------MANERNRTIVENYICHKLSKRGYAWG
A0A3Q2XQX2_BCL2-01      ------------------------MANERNRTIVENYICHKLSKRGYAWG
A0A3Q3B0R2_BCL2-01      --------------------------MEVNRFIVENYICHKLSKRGYAWG
A0A3Q2PN77_BCL2-01      ------------------------MANDCNRDIVENYIFHKLSKRGYAWR
A0A3P9J8Y9_BCL2-01      ------------------------MANVSNRSIVEKYICHKLSKRGYVCG
A0A3Q0S5Z7_BCL2-01      ------------------------MANEYNRNIVEKYICHKLSKRGYAWG
A0A3P8QVM8_BCL2-01      ------------------------MENEYNRNIVEKYICHKLSKRGFVWG
A0A3P9DIG5_BCL2-01      ------------------------MENEYNRNIVEKYICHKLSKRGFVWG
A0A3Q2UYW8_BCL2-01      ------------------------MANEYNRNIVEKYICHKLSKRGFVWG
A0A3B4G3K4_BCL2-01      ------------------------MANEYNRNIVEKYICHKLSKRGFVWG
A0A2U9BJ09_BCL2-01      ------------------------MASECNRNIVEKYICHKLSKRGYVWG
A0A3Q1I5N1_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKRGYAWG
A0A3Q3K1K1_BCL2-01      ------------------------MANECNRNVVEKYICHKLSKRGYVWG
A0A3Q3MEY1_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKRGYVWG
A0A1X9JZA1_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKQGYEWG
A0A4D6FTA2_BCL2-01      ------------------------MANERNRNIVEKYICHKLSKQGYVWG
A0A3Q1FLK7_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKRGYVWG
A0A3Q1B8C3_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKRGYVWG
A0A3P8S9L3_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKRGYVWG
A0A3B5BBQ0_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKRGYAWG
A0A3B4TX71_BCL2-01      ------------------------MASEYNRNIVEKYICHKLSKQGYVWG
A0A3B4YAG2_BCL2-01      ------------------------MASEYNRNIVEKYICHKLSKRGYVWG
G1TW27_BCL2-02          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A3B3TCS4_BCL2-01      ---------------------MANDVPYDSRNIVEIYIYHKLLKTGYVWE
A0A0U3DHY6_BCL2-01      ---------------------MANENPYDSRFIVEKYIHNKLLKKGFVWE
A0A3P9AAB2_BCL2-01      ---------------------MANENPYDSRVIVENYIYDKLLKNGFVWE
F6YNL8_BCL2-01          ------------------MMAHPGRRGYDNREIVMKYIHYKLSQRGYEWD
A0A218UQA0_BCL2-01      -------------------MAHPGRRGYDNREIVLKYIHYKLSQRGYDWA
Q00709_BCL2-01          -------------------MAHPGRRGYDNREIVLKYIHYKLSQRGYDWA
A0A493T1X3_BCL2-01      -------------------MAHPGRRGYDNREIVLKYIHYKLSQRGYDWA
U3KEW4_BCL2-01          -------------------MAHPGRRGYDNREIVLKYIHYKLSQRGYDWA
G3WZW9_BCL2-01          -------------------MAHPGRRGYDNREIVMKYIHYKLSQRGYEWD
A0A452R110_BCL2-02      -------------------------------------------------M
E2QWA1_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-01          --------------------------------------------------
A0A452R110_BCL2-01      -------------------------------------------------M
M3YYK3_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRG----
A0A2K6R2I5_BCL2-02      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2R9APW6_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
M3X1R9_BCL2-02          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
G3SLZ1_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWE
Q75SV7_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
M3X1R9_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
Q8I008_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYELPQRGYEWD
A0A076FU27_BCL2-01      -------------------MAHAGGTGYDNREIVMKYIHYKLSQRGYEWD
A0A4P8GLJ2_BCL2-01      -------------------MAHAGGTGYDNREIVMKYIHYKLSQRGYEWD
F6R2C4_BCL2-01          -------------------MAHAGGTGYDNREIVMKYIHYKLSQRGYEWD
O02718_BCL2-01          -------------------MAHAGGTGYDNREIVMKYIHYKLSQRGYEWD
A0A076FZV9_BCL2-01      -------------------MAHAGGTGYDNREIVMKYIHYKLSQRGYEWD
A0A452EV13_BCL2-01      -------------------MAHAGGTGYDNREIVMKYIHYKLSQRGYEWD
A0A250YD83_BCL2-01      -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
A9QXG9_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K5NZS5_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A0D9S017_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K6CIX3_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K5XRD4_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K6KHG1_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K6R2I5_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K5HK49_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
G3QES9_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
H2QEM8_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2I3GZF9_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K6UEL3_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
G3WZW9_BCL2-02          ---PFGCSPWCSLLSPLGIMAHPGRRGYDNREIVMKYIHYKLSQRGYD--
G3SLZ1_BCL2-02          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWE
A0A452T603_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYD--
X4ZGI8_BCL2-01          ---------------------MANEIRYDNRNIVEKYLNHKLSKKGYEWK
B9ZYL7_BCL2-01          -------------------MAHPRRGGYDHRDIVVKYIHYKLSQKGYAWE
Q564A4_BCL2-01          ---------------------MANEISYDNRNIVEKYLKHKLSKRGYVWK
H9GPE7_BCL2-01          -------------------MAHPGIRGYDNREIVLRYIHYKLSQKGYDWV
A0A452I9V7_BCL2-01      MYLTACVCTLHWREKHSTSARAWSQRGYDNREIVLKYIHYKLSQRGYDWA
W5N4F7_BCL2-01          --------------------MANNEAPYDTRNIVTKYIHHKLLKKGYVWE
K7F5Y3_BCL2-02          -------------------MAHPGRRGYDNREIVLKYIHYKLSQRGYDWA
A0A3Q2HRY3_BCL2-02      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
H0YUX3_BCL2-01          -------------------MAHPGRRGYDNREIVLKYIHYKLSQRGYDWA
K7F5Y3_BCL2-01          -------------------MAHPGRRGYDNREIVLKYIHYKLSQRGYDWA
F1LNV0_BCL2-01          -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
P49950_BCL2-01          -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
G1TW27_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K5EB04_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2R8MY14_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
H2NWH5_BCL2-01          -------------------MAHAGTTGYDNREIVDEXIHYKLSQRGYEWD
A0A096MPU7_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K5PP81_BCL2-01      -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
H0WKI0_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K5UDI5_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
P10417_BCL2-01          -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
Q7TSN8_BCL2-01          -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A3Q2HRY3_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
E2QWA1_BCL2-02          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K6G3I7_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLAQRGYEWD
Q6R755_BCL2-01          -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
Q9JJV8_BCL2-01          -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
Q923R6_BCL2-01          -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
H0W1T3_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
G1LIC9_BCL2-02          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
I3MVK9_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
                                                                          

G1MZW1_BCL2-01          --------------------------------------------------
A0A3P8YNB4_BCL2-01      F--E-------------------DAE--EEDGANNGSMISPPPGLVRRIH
A0A3P8WUE9_BCL2-01      H--D-------------------EDR--DGDAANNGSIVSRPPTLVHRCR
A0A3B4A3G8_BCL2-01      FHED-------------------AED--EGDVANNGSIVASSPVLVNRRC
A0A3Q3G1D7_BCL2-01      F--E-------------------DEQ--DEDAANNGSLVAPPPTLVRRCR
A0A3Q2XQX2_BCL2-02      F--G-------------------AGE--ED--------------------
A0A3Q2XQX2_BCL2-01      F--G-------------------AED--DAAAANNGLLVAPSPTLVLRCR
A0A3Q3B0R2_BCL2-01      S--D-------------------RPRRVRDDAANNGSVASQSPTLVRRCR
A0A3Q2PN77_BCL2-01      F--D-------------------GVR--DDDAAANGGLGDRSPTLVRRCR
A0A3P9J8Y9_BCL2-01      L--N-------------------GGQ--RENAANNGSVGDHSPTPVRRRC
A0A3Q0S5Z7_BCL2-01      F--D-------------------GVQ--DEDAANNGSINDPPPTLVRRCR
A0A3P8QVM8_BCL2-01      F--R-------------------VVQ--EEDAANNGSITDPPPTLVHRCR
A0A3P9DIG5_BCL2-01      F--R-------------------VVQ--EEDAANNGSITDPPPTLVHRCR
A0A3Q2UYW8_BCL2-01      F--R-------------------VVQ--EEDAANNGSITDPPPTLVHRCR
A0A3B4G3K4_BCL2-01      F--R-------------------VVQ--EEDAANNGSITDPPPTLVHRCR
A0A2U9BJ09_BCL2-01      F--D-------------------DVR--DEDAADNGSIVAPPPTLVRRCH
A0A3Q1I5N1_BCL2-01      F--H-------------------DAQ--DEDAANNGSAVPPPPTLVRRCR
A0A3Q3K1K1_BCL2-01      F--H-------------------DVQ--DEDAANNGSIVAPPPTLVRRCR
A0A3Q3MEY1_BCL2-01      F--H-------------------NVQ--DEDAANNGSVVAPPPTVVRRCR
A0A1X9JZA1_BCL2-01      F--D-------------------AVR--NADAGNNGSIVAPPPSLVRRCR
A0A4D6FTA2_BCL2-01      F--D-------------------DVR--DEDAANNGSIVAPPPTLVRRCR
A0A3Q1FLK7_BCL2-01      F--D-------------------DVR--DEDAANNGSVVDPPPTLVRRCH
A0A3Q1B8C3_BCL2-01      F--D-------------------DVR--DEDAANNGSVVDPPPTLVRRCH
A0A3P8S9L3_BCL2-01      F--D-------------------DVR--DEDAANNGSVVDPPPTLVRRCH
A0A3B5BBQ0_BCL2-01      F--D-------------------DVR--DEDAANNGSVVDPPPTLVRRCH
A0A3B4TX71_BCL2-01      F--D-------------------DVR--DEDAANNGSIVAPPPTLVRRCR
A0A3B4YAG2_BCL2-01      F--D-------------------DVR--DEDAANNGSIVAPPPTLVRRCR
G1TW27_BCL2-02          A--G-------------------DA------------GAASAPGVFSSQP
A0A3B3TCS4_BCL2-01      F--Q---------------------------------AAGDTDSPNNGSV
A0A0U3DHY6_BCL2-01      F--Q---------------------------------AENDSPNNLFGDP
A0A3P9AAB2_BCL2-01      F--Q---------------------------------TENQSRNNVFEDP
F6YNL8_BCL2-01          A--G-------------------DLRAPASPSLPPVVASAPAVGIFSTQP
A0A218UQA0_BCL2-01      A--G-------------------E-------------DRVSLPPDHSASA
Q00709_BCL2-01          A--G-------------------E-------------DRPPVPPAPAPAA
A0A493T1X3_BCL2-01      A--G-------------------E-------------DRAPAPTALAPAA
U3KEW4_BCL2-01          A--G-------------------E-------------HRAPLPPGLSAPA
G3WZW9_BCL2-01          A--G-------------------NLRTPASPSLPPVVASAPAVGIFSNQP
A0A452R110_BCL2-02      P--E-------------------TRAPRPR-------GPPPRRASSPPSL
E2QWA1_BCL2-01          ------------------------------------------PFQFGGCP
G1LIC9_BCL2-01          -----------------------------------------------PHP
A0A452R110_BCL2-01      P--E-------------------TRAPRPR-------GPPPRRASSPPSL
M3YYK3_BCL2-01          ---------------------------------------RPVMKLVYLPT
A0A2K6R2I5_BCL2-02      A--G-------------------DVGAATP-------GAAPAPGIFSSQP
A0A2R9APW6_BCL2-01      A--G-------------------DVGAAP---------------------
M3X1R9_BCL2-02          A--G-------------------DAGAAPP-------GAAPAPGIFSSQP
G3SLZ1_BCL2-01          A--G-------------------EASAAPP-------GAAPAPGVLSSPP
Q75SV7_BCL2-01          A--G-------------------EAGAAPP-------GAAPAPGIFSSQP
M3X1R9_BCL2-01          A--G-------------------DAGAAPP-------GAAPAPGIFSSQP
Q8I008_BCL2-01          A--G-------------------DAGAAPP-------GAAPAPGIFSSQP
A0A076FU27_BCL2-01      A--R-------------------AAGAAPP-------GAAPAPGILSSQP
A0A4P8GLJ2_BCL2-01      A--G-------------------DAGAAPP-------GAAPAPGILSSQP
F6R2C4_BCL2-01          A--G-------------------DAGAAPP-------GAAPAPGILSSQP
O02718_BCL2-01          A--G-------------------DAGAAPP-------GAAPAPGILSSQP
A0A076FZV9_BCL2-01      A--G-------------------AAGAAPP-------GAAPAPGILSSQP
A0A452EV13_BCL2-01      A--G-------------------AAGAAPP-------GAAPAPGILSSQP
A0A250YD83_BCL2-01      A--G-------------------DVGAAPP-------EATPAPGIFSFQP
A9QXG9_BCL2-01          A--G-------------------DVGAAPP-------GAAPAPGIFSSQP
A0A2K5NZS5_BCL2-01      A--G-------------------DVGAATP-------GVAPAPGIFSSQP
A0A0D9S017_BCL2-01      A--G-------------------DVGAATP-------GAAPAPGIFSSQP
A0A2K6CIX3_BCL2-01      A--G-------------------DVGAATP-------GAAPAPGIFSSQP
A0A2K5XRD4_BCL2-01      A--G-------------------DVGAATP-------GVAPAPGIFSSQP
A0A2K6KHG1_BCL2-01      A--G-------------------DVGAATP-------GAAPAPGIFSSQP
A0A2K6R2I5_BCL2-01      A--G-------------------DVGAATP-------GAAPAPGIFSSQP
A0A2K5HK49_BCL2-01      A--G-------------------DVGAATP-------GAAPAPGIFSSQP
G3QES9_BCL2-01          A--G-------------------DVGAVPP-------GAAPAPGIFSSQP
H2QEM8_BCL2-01          A--G-------------------DVGAAPP-------GAAPAPGIFSSQP
A0A2I3GZF9_BCL2-01      A--G-------------------DVGAAPP-------GAAPAPGIFSSQP
A0A2K6UEL3_BCL2-01      A--G-------------------DVGAAPP-------GAAPAPGIFSSQP
G3WZW9_BCL2-02          ------------------------------------------V-------
G3SLZ1_BCL2-02          A--G-------------------EADTRTS-------PLQADP-------
A0A452T603_BCL2-01      --------------------------------------------------
X4ZGI8_BCL2-01          F--Q-------------------SSGEDDDTINTGVEDSSPSSDRRLQAP
B9ZYL7_BCL2-01          E--GRQQVSAEHPQASAAISNYSDDGEMPAASADSRGPPQSSLASAASSD
Q564A4_BCL2-01          C--Q---------------------------------SSAEEDDTFNKAV
H9GPE7_BCL2-01          A--S-------------------GDRGK---------SASLSPELLNSDP
A0A452I9V7_BCL2-01      A--N-------------------ENRGPVS-------PNLSPPTVTGTSS
W5N4F7_BCL2-01          S--R-------------------VSGETDPPNNGLVGPSASGPGLQARRL
K7F5Y3_BCL2-02          A--N-------------------E-NRGPV-------SSSLSPPAAGTPS
A0A3Q2HRY3_BCL2-02      A--G-------------------DAGAAPL-------GATPVPGIFSSQP
H0YUX3_BCL2-01          A--G-------------------EDRASLP-------PDHSASAAAAIAA
K7F5Y3_BCL2-01          A--N-------------------E-NRGPV-------SSSLSPPAAGTPS
F1LNV0_BCL2-01          T--G-------------------DEDSAPL-------RAAPTPGIFSFQP
P49950_BCL2-01          T--G-------------------DEDSAPL-------RAAPTPGIFSFQP
G1TW27_BCL2-01          A--G-------------------DA------------GAASAPGVFSSQP
A0A2K5EB04_BCL2-01      A--G-------------------DVGAAPP-------GAAPAPGIFSSQP
A0A2R8MY14_BCL2-01      A--G-------------------DVGAAPP-------GAAPAEGIFSSQP
H2NWH5_BCL2-01          A--G-------------------DVGAAPP-------GAATAPGIFSSQP
A0A096MPU7_BCL2-01      A--G-------------------D-GAATP-------GAAPAPGIFSSQP
A0A2K5PP81_BCL2-01      A--G-------------------DVGAAPP-------GAAPAPGIFSSQP
H0WKI0_BCL2-01          A--G-------------------DVGVAPP-------GAATAPGVFSSQP
A0A2K5UDI5_BCL2-01      A--G-------------------DVGAATP-------GAAPAPGIFSSQP
P10417_BCL2-01          A--G-------------------DADAAPL-------GAAPTPGIFSFQP
Q7TSN8_BCL2-01          A--G-------------------DADAAPL-------GAAPTPGIFSFQP
A0A3Q2HRY3_BCL2-01      A--G-------------------DAGAAPL-------GATPVPGIFSSQP
E2QWA1_BCL2-02          A--G-------------------EAGAAPP-------GAAPAPGISASQX
A0A2K6G3I7_BCL2-01      A--G-------------------DAGAAPP-------GAAPTPGIFSSQP
Q6R755_BCL2-01          V--G-------------------DVDAAPL-------GAAPTPGIFSFQP
Q9JJV8_BCL2-01          V--G-------------------DVDAAPL-------GAAPTPGIFSFQP
Q923R6_BCL2-01          V--G-------------------DVDAAPL-------GAAPTPGIFSFQP
H0W1T3_BCL2-01          A--G-------------------DGSALGR-------NSPLGV-------
G1LIC9_BCL2-02          A--G-------------------DAAPAA---------------------
I3MVK9_BCL2-01          A--G-------------------DVGAASP-------GAAPGPGIFSSQP
                                                                          

G1MZW1_BCL2-01          --------------------------------------------------
A0A3P8YNB4_BCL2-01      GASK-------------------------A----------GQGSVPHISK
A0A3P8WUE9_BCL2-01      GAST------------------------GP----------GNDGIPNLCK
A0A3B4A3G8_BCL2-01      RAER---------------------------------------------L
A0A3Q3G1D7_BCL2-01      EASS------------------------GP----------DRESIPHLCK
A0A3Q2XQX2_BCL2-02      -------------------------------------------------D
A0A3Q2XQX2_BCL2-01      EASS------------------------GP----------ERDCAP---K
A0A3Q3B0R2_BCL2-01      GARG------------------------APGGAGTAPPDAESDPDPVLCG
A0A3Q2PN77_BCL2-01      DAAA-----------------------PGQ----------DSDGDPRRVR
A0A3P9J8Y9_BCL2-01      DAGT------------------------GP----------DEESSPRLIR
A0A3Q0S5Z7_BCL2-01      EPSN------------------------GP----------DGESNTHLCR
A0A3P8QVM8_BCL2-01      EAST------------------------GP----------DGESNTHLCR
A0A3P9DIG5_BCL2-01      EAST------------------------GP----------DGESNTHLCR
A0A3Q2UYW8_BCL2-01      EAST------------------------GP----------DGESNTHLCR
A0A3B4G3K4_BCL2-01      EAST------------------------GP----------DGESNTHLCR
A0A2U9BJ09_BCL2-01      GAST------------------------GP----------DDESHPDLCR
A0A3Q1I5N1_BCL2-01      EAST------------------------GP----------DSDSIPQHCR
A0A3Q3K1K1_BCL2-01      EAST------------------------GP----------DSESTPHRCK
A0A3Q3MEY1_BCL2-01      DAST------------------------GP----------DSESIPQLCR
A0A1X9JZA1_BCL2-01      GAST------------------------GP----------DSESIPHLCT
A0A4D6FTA2_BCL2-01      EAST------------------------GP----------DTESIPHLCK
A0A3Q1FLK7_BCL2-01      EAST------------------------GP----------DNESDPHLCR
A0A3Q1B8C3_BCL2-01      EAST------------------------GP----------DNESDPHLCR
A0A3P8S9L3_BCL2-01      EAST------------------------GP----------DNESDPHLCR
A0A3B5BBQ0_BCL2-01      EAST------------------------GP----------DNESDPHLCR
A0A3B4TX71_BCL2-01      EANT------------------------GP----------DNDSSPNLCR
A0A3B4YAG2_BCL2-01      EANT------------------------GP----------DNDSSPNLCR
G1TW27_BCL2-02          --------------APAAPRD------PAARTSPPPPPA-----------
A0A3B3TCS4_BCL2-01      DSPP----------GSQV---------LARRSQAAAAGGEDASPVRSRTP
A0A0U3DHY6_BCL2-01      STPN----------TPEV---------FARRSQPTAAVEDTDSPFQNRSP
A0A3P9AAB2_BCL2-01      SPPN----------SPEL---------FARRLQPPAAGEDNDPQFANRIP
F6YNL8_BCL2-01          RNTP----------LPAAA-------------------------------
A0A218UQA0_BCL2-01      AAAI----------AAAG--TSDHTGLVSPHPEPPGSATASHT-------
Q00709_BCL2-01          APAA----------VAAAGASSHH------RPEPPGSAAASEV-------
A0A493T1X3_BCL2-01      AAVA----------AAGTPSRHRPAGLLSPHPEPPGSAAASEA-------
U3KEW4_BCL2-01          AAAV----------AAAAGTSSDHTGPVSPHPEPPGSAAASPA-------
G3WZW9_BCL2-01          RHTP----------LPAAPQDLATSTTAAARNSPLPPPPAVAAATV----
A0A452R110_BCL2-02      GSPP----------RPPGPR----------RLPPPAAPAAAAA-------
E2QWA1_BCL2-01          VSFS----------GP-------------ELASPPPPPGPPAAAAAAAFP
G1LIC9_BCL2-01          AASP----------RPFVRR----------WQVAP--PSAAAA-------
A0A452R110_BCL2-01      GSPP----------RPPGPR----------RLPPPAAPAAAAA-------
M3YYK3_BCL2-01          APPP----------PPLSRHR------RPQLTSPATALAAAA--------
A0A2K6R2I5_BCL2-02      GHTP----------HPAASRD------PVARTSPLPTPAAPAA-------
A0A2R9APW6_BCL2-01      --------------------------------------------------
M3X1R9_BCL2-02          GRTP----------AP-------------ARTSPPPPPVAPAAAAAAA--
G3SLZ1_BCL2-01          AAPR----------GPD------------TRTSPLQADP-----------
Q75SV7_BCL2-01          GRAP----------AP-------------ARTSPPPPPAAPAAAAAAAAD
M3X1R9_BCL2-01          GRTP----------AP-------------ARTSPPPPPVAPAAAAAAA--
Q8I008_BCL2-01          GRTP----------AP-------------ARTSPPPPPVAP--AAAAA--
A0A076FU27_BCL2-01      GRTP----------AP-------------SRTSPPPPPAA----------
A0A4P8GLJ2_BCL2-01      GRTP----------AP-------------SRTSPPPPPAA----------
F6R2C4_BCL2-01          GRTP----------AP-------------SRTSPPPPPAA----------
O02718_BCL2-01          GRTP----------AP-------------SRTSPPPPPAA----------
A0A076FZV9_BCL2-01      GRTP----------AP-------------SRTSPPPPPAA----------
A0A452EV13_BCL2-01      GRAP----------AP-------------SRTSPPPPPAA----------
A0A250YD83_BCL2-01      GSNP----------LPAAPRD------RAARTTSLPPPVAPAA-------
A9QXG9_BCL2-01          GHTP----------HPAASRD------PVARTSPLQTPAAPGA-------
A0A2K5NZS5_BCL2-01      GHTP----------HPAASRD------PVARTSPLPTPAAPAA-------
A0A0D9S017_BCL2-01      GHTP----------HPAASRD------PVARTSPLPTPAAPAA-------
A0A2K6CIX3_BCL2-01      GHTP----------HPAASRD------PVARTSPLPTPAAPAA-------
A0A2K5XRD4_BCL2-01      GHTP----------HPAASRD------PVARTSPLPTPAAPAA-------
A0A2K6KHG1_BCL2-01      GHTP----------HPAASRD------PVARTSPLPTPAAPAA-------
A0A2K6R2I5_BCL2-01      GHTP----------HPAASRD------PVARTSPLPTPAAPAA-------
A0A2K5HK49_BCL2-01      GHTP----------HPAASRD------PVARTSPLPTPAAPAA-------
G3QES9_BCL2-01          GHTP----------HPAASRD------RVARTSPLQTPAAPGA-------
H2QEM8_BCL2-01          GHTP----------HPAASRD------PVARTSPLQTPAAPGA-------
A0A2I3GZF9_BCL2-01      GHTP----------HPAASRD------PVARTSPLPTPAAPGA-------
A0A2K6UEL3_BCL2-01      GHTP----------GPAAPRD------PVARTXXXXXXXXXXX-------
G3WZW9_BCL2-02          --------------------------------------------------
G3SLZ1_BCL2-02          --------------------------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
X4ZGI8_BCL2-01          SAGG----------GNNSECL------IANRVTRSDPY------------
B9ZYL7_BCL2-01          EETPSNTPITFVGNAPAVPRR------SASAVSPLAELNVEPRDLN----
Q564A4_BCL2-01          EESS----------PNSDRRL------QAPSAGGGNNSECLIARVT----
H9GPE7_BCL2-01          VSTN----------APREEPD-----------------------------
A0A452I9V7_BCL2-01      DHAG----------LMSLPPE------PPGSAAASNVP------------
W5N4F7_BCL2-01          QAAG----------AERGAVP------VPRRTPPPDPH------------
K7F5Y3_BCL2-02          DHAG----------LVSLPPE------PPGSAAASNVP------------
A0A3Q2HRY3_BCL2-02      GRTP----------AP-------------ARTSPLLPP---AAPAG----
H0YUX3_BCL2-01          AAIA----------AAGTSDH------TGLVSPHPEPPGSATASHT----
K7F5Y3_BCL2-01          DHAG----------LVSLPPE------PPGSAAASNVP------------
F1LNV0_BCL2-01          ESNR----------TPAVHRD------TAARTSPLRPL------VA----
P49950_BCL2-01          ESNR----------TPAVHRD------TAARTSPLRPL------VA----
G1TW27_BCL2-01          --------------APAAPRD------PAARTSPPPPP-------A----
A0A2K5EB04_BCL2-01      GHTP----------GPAAPRD------PVSRTSPPPPP--AAPAAA----
A0A2R8MY14_BCL2-01      GHTP----------GPAAPRD------PVARTSPPPPP--AAPAAA----
H2NWH5_BCL2-01          GHTP----------HPAASRD------P-ARTSPLPTP---AAPGA----
A0A096MPU7_BCL2-01      GHTP----------HPAASRD------PVARTSPLPTP---AAPAA----
A0A2K5PP81_BCL2-01      GHTP----------GPAAPRD------PVARTSPPSPP--AAPAAA----
H0WKI0_BCL2-01          GRTP----------TPAAPRD------PAARTSPPAAP----AAAA----
A0A2K5UDI5_BCL2-01      GHTP----------HPAASRD------PVARTSPLPTPAAPAAAAA----
P10417_BCL2-01          ESNP----------MPAVHRD------MAARTSPLRPL------VA----
Q7TSN8_BCL2-01          ESNP----------MPAVHRD------MAARTSPLRPL------VA----
A0A3Q2HRY3_BCL2-01      GRTP----------APA--RT------SPLLPPA--AP------AG----
E2QWA1_BCL2-02          -XXX----------XXXXXXX------XXXXXXX--XX------XX----
A0A2K6G3I7_BCL2-01      GRNP----------PPAAPRD------PAARTSP--PP------AA----
Q6R755_BCL2-01          ESNP----------TPAVHRD------MAARTSPLRPI------VA----
Q9JJV8_BCL2-01          ESNP----------TPAVHRD------MAARTSPLRPI------VA----
Q923R6_BCL2-01          ESNP----------TPAVHRD------MAARTSPLRPI------VA----
H0W1T3_BCL2-01          ------------------PRD------PAARTSPPPPL---AGLAV----
G1LIC9_BCL2-02          --------------------------------------------AA----
I3MVK9_BCL2-01          G-----------------SHT------PAARTSPPPPP---AAPAA----
                                                                          

G1MZW1_BCL2-01          --------------------------------------------------
A0A3P8YNB4_BCL2-01      -WLSQ------------------PDP-HAAIHRVLREAGDELERLYQPDF
A0A3P8WUE9_BCL2-01      -RPPA------------------PEA-HAAIHRVLREAGDELERLYQPDF
A0A3B4A3G8_BCL2-01      -CSAP------------------SDP-HAAIHRVLREAGDELERLYQPDF
A0A3Q3G1D7_BCL2-01      -RPPQ------------------SDPAYADIHRVLREAGDELERLYQPDF
A0A3Q2XQX2_BCL2-02      -RSHG------------------SDP-LADIHRVLREAGDELERLYQPDF
A0A3Q2XQX2_BCL2-01      -RSHG------------------SDP-LADIHRVLREAGDELERLYQPDF
A0A3Q3B0R2_BCL2-01      -RISP------------------HEP-LAHIHRVLREAGDELERLYQPDF
A0A3Q2PN77_BCL2-01      GRLSQ------------------SDP-HADIHRVLREAGDELERLYQLDF
A0A3P9J8Y9_BCL2-01      -ALSR------------------ADP-LADIHRVLREAGDELERLYQRDF
A0A3Q0S5Z7_BCL2-01      -RLPQ------------------SDP-HADIHRVLREAGDELERLYQPDF
A0A3P8QVM8_BCL2-01      -RLPQ------------------SDP-HAGIHRVLREAGDELERLYQPDF
A0A3P9DIG5_BCL2-01      -RLPQ------------------SDP-HAGIHRVLREAGDELERLYQPDF
A0A3Q2UYW8_BCL2-01      -RLPQ------------------SDP-HAGIHRVLREAGDELERLYQPDF
A0A3B4G3K4_BCL2-01      -RLPQ------------------SDP-HAGIHRVLREAGDELERLYQPDF
A0A2U9BJ09_BCL2-01      -RPPQ------------------SEP-RAAVHRVLREAGDELERLYQPDF
A0A3Q1I5N1_BCL2-01      -RLPP------------------SDP-HAALHRVLREAGDELERLYQPDF
A0A3Q3K1K1_BCL2-01      -RPPQ------------------SDM-HAAIHRVLREAGDELERLYQPDF
A0A3Q3MEY1_BCL2-01      -GLPQ------------------SDP-QAAIHRVLREAGDELERLYQPDF
A0A1X9JZA1_BCL2-01      -RLPQ------------------SDP-HAAIHRVLREAGDELERLYQPDF
A0A4D6FTA2_BCL2-01      -RLPQ------------------SDP-HAAIHRVLREAGDELERLYQPDF
A0A3Q1FLK7_BCL2-01      -RLPQ------------------SDP-HAAIHRVLREAGDELERLYQPDF
A0A3Q1B8C3_BCL2-01      -RLPQ------------------SDP-HAAIHRVLREAGDELERLYQPDF
A0A3P8S9L3_BCL2-01      -RLPQ------------------SDP-HAAIHRVLREAGDELERLYQPDF
A0A3B5BBQ0_BCL2-01      -RLPQ------------------SDP-HAAIHRVLREAGDELERLYQPDF
A0A3B4TX71_BCL2-01      -RLSQ------------------SDP-HAEIHRVLREAGDELERLYQPDF
A0A3B4YAG2_BCL2-01      -RLSQ------------------SDP-HAEIHRVLREAGDELERLYQPDF
G1TW27_BCL2-02          AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A3B3TCS4_BCL2-01      RFDPH-----------------------ARLHRVLREAGDEIERMFQRDF
A0A0U3DHY6_BCL2-01      QPDPH-----------------------VRLHRVLREAGDEIERMYLRDF
A0A3P9AAB2_BCL2-01      QPDPH-----------------------ARLHRVLRDAGNEIERMYQRDF
F6YNL8_BCL2-01          AAGPT------------------VSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A218UQA0_BCL2-01      PPAEG------------------LRPAPQVVHLVLRQAGDEFSRRYQRDF
Q00709_BCL2-01          PPAEG------------------LRPAPPGVHLALRQAGDEFSRRYQRDF
A0A493T1X3_BCL2-01      PPGEG------------------LRPAPPVVHLALRQAGDEFSRRYQRDF
U3KEW4_BCL2-01          PPAEG------------------LRPAPQVVHLVLRQAGDEFSRRYQRDF
G3WZW9_BCL2-01          AAGPA------------------VSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A452R110_BCL2-02      AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
E2QWA1_BCL2-01          PRAPX------------------XSPVPPVVHLTLRQAGDDFSRRYRR-F
G1LIC9_BCL2-01          AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A452R110_BCL2-01      AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
M3YYK3_BCL2-01          AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A2K6R2I5_BCL2-02      AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A2R9APW6_BCL2-01      -----------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
M3X1R9_BCL2-02          AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
G3SLZ1_BCL2-01          AAQPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
Q75SV7_BCL2-01          AAGPA------------------PSPVPPVVHLTLRQAGDDFSRRYRRDF
M3X1R9_BCL2-01          AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
Q8I008_BCL2-01          AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A076FU27_BCL2-01      AAGPA------------------PSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A4P8GLJ2_BCL2-01      AAGPA------------------PSPVPPVVHLTLRQAGDDFSRRYRRDF
F6R2C4_BCL2-01          AAGPA------------------PSPVPPVVHLTLRQAGDDFSRRYRRDF
O02718_BCL2-01          AAGPA------------------PSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A076FZV9_BCL2-01      AAGPA------------------PSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A452EV13_BCL2-01      AAGPA------------------PSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A250YD83_BCL2-01      RAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
A9QXG9_BCL2-01          AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A2K5NZS5_BCL2-01      AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A0D9S017_BCL2-01      AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A2K6CIX3_BCL2-01      AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A2K5XRD4_BCL2-01      AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A2K6KHG1_BCL2-01      AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A2K6R2I5_BCL2-01      AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A2K5HK49_BCL2-01      AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
G3QES9_BCL2-01          AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
H2QEM8_BCL2-01          AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A2I3GZF9_BCL2-01      AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A2K6UEL3_BCL2-01      XXXXX------------------XSPVPPVVHLTLRQAGDDFSRRYRRDF
G3WZW9_BCL2-02          AAGPA------------------VSPVPPVVHLTLRQAGDDFSRRYRRDF
G3SLZ1_BCL2-02          AAQPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A452T603_BCL2-01      -------------------------PVPPVVHLTLRQAGDDFSRRYRRDF
X4ZGI8_BCL2-01          ----------------------------SRIYRSLREAGDQIERMYQREF
B9ZYL7_BCL2-01          VNPDASRAADGDNNDADGGDEAVMQPVPSAVLQTLSRAGDEFSRLYQQDF
Q564A4_BCL2-01          RSDPH------------------LR-----LYRVLRDAGDEIERIYQREF
H9GPE7_BCL2-01          -------------------------PVPQVVHTTLRQAGDEFSRRYRRDF
A0A452I9V7_BCL2-01      -LGDG------------------LRPAPQAVLLALCQAGDEFSRRYHRDF
W5N4F7_BCL2-01          ----------------------------AALHKVLREAGDEIERMYHRDF
K7F5Y3_BCL2-02          -LGDG------------------LRSAPQAVHLTLCQAGDEFSRRYHRDF
A0A3Q2HRY3_BCL2-02      AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
H0YUX3_BCL2-01          PPAEG------------------LRPAPQAVHLVLRQAGDEFSRRYQRDF
K7F5Y3_BCL2-01          -LGDG------------------LRSAPQAVHLTLCQAGDEFSRRYHRDF
F1LNV0_BCL2-01          TAGPA------------------LSPVPPVVHLTLRRAGDDFSRRYRRDF
P49950_BCL2-01          NAGPA------------------LSPVPPVVHLTLRRAGDDFSRRYRRDF
G1TW27_BCL2-01          AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A2K5EB04_BCL2-01      ATGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A2R8MY14_BCL2-01      ATGPT------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
H2NWH5_BCL2-01          AVGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A096MPU7_BCL2-01      AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A2K5PP81_BCL2-01      ATGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
H0WKI0_BCL2-01          AAEPL------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
A0A2K5UDI5_BCL2-01      AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
P10417_BCL2-01          TAGPA------------------LSPVPPVVHLTLRRAGDDFSRRYRRDF
Q7TSN8_BCL2-01          TAGPA------------------LSPVPPVVHLTLRRAGDDFSRRYRRDF
A0A3Q2HRY3_BCL2-01      AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
E2QWA1_BCL2-02          XXXXX------------------XSPVPPVVHLTLRQAGDDFSRRYRR-F
A0A2K6G3I7_BCL2-01      AAGPA------------------PSPVPPVVHLTLRQAGDDFSRRYRRDF
Q6R755_BCL2-01          TTGPT------------------LSPVPPVVHLTLRRAGDDFSRRYRRDF
Q9JJV8_BCL2-01          TTGPT------------------LSPVPPVVHLTLRRAGDDFSRRYRRDF
Q923R6_BCL2-01          TTGPT------------------LSPVPPVVHLTLRRAGDDFSRRYRRDF
H0W1T3_BCL2-01          AQGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRQDF
G1LIC9_BCL2-02          AAGPA------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
I3MVK9_BCL2-01          AAGPV------------------LSPVPPVVHLTLRQAGDDFSRRYRRDF
                                                                          

G1MZW1_BCL2-01          ---------------------VEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A3P8YNB4_BCL2-01      LEMSHQLYLTSSVAERRFREVIDELFRDGVNWGRIIAFFEFGGTICVECV
A0A3P8WUE9_BCL2-01      SEMSRQLYLTSSTAQRRFTEVIDELFRDGVNWGRIIAFFEFGGVVCVECA
A0A3B4A3G8_BCL2-01      TEMSRQLYLTSSTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECA
A0A3Q3G1D7_BCL2-01      TEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECM
A0A3Q2XQX2_BCL2-02      TEMSRQLYLSSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECA
A0A3Q2XQX2_BCL2-01      TEMSRQLYLSSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECA
A0A3Q3B0R2_BCL2-01      VEMSRQLGLASAAAKARFAEVMDELFRDGVNWGRIIAFFEFGGTVCVECA
A0A3Q2PN77_BCL2-01      AEMSQQLYITRDTARTRFAEVVDELFRDGVNWGRIIAFFEFGGTVCVECA
A0A3P9J8Y9_BCL2-01      TEMSRQLYLTSTTAKTRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECA
A0A3Q0S5Z7_BCL2-01      TEMSRQLHLTSATAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECA
A0A3P8QVM8_BCL2-01      TEMSRQLHLTSSTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECA
A0A3P9DIG5_BCL2-01      TEMSRQLHLTSSTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECA
A0A3Q2UYW8_BCL2-01      TEMSRQLHLTSATAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECA
A0A3B4G3K4_BCL2-01      TEMSRQLHLTSATAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECA
A0A2U9BJ09_BCL2-01      TEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECA
A0A3Q1I5N1_BCL2-01      TEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECA
A0A3Q3K1K1_BCL2-01      TEMSRQLHLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTMCVECA
A0A3Q3MEY1_BCL2-01      TEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECA
A0A1X9JZA1_BCL2-01      TEMSRQLYLTSTTAQRRFADVIDELFRDGVNWGRIIAFFEFGGTVCVECV
A0A4D6FTA2_BCL2-01      TEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECV
A0A3Q1FLK7_BCL2-01      TEMSRQLYLTTTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECA
A0A3Q1B8C3_BCL2-01      TEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECA
A0A3P8S9L3_BCL2-01      TEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECA
A0A3B5BBQ0_BCL2-01      TEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECA
A0A3B4TX71_BCL2-01      TEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECA
A0A3B4YAG2_BCL2-01      TEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECA
G1TW27_BCL2-02          AEMSSQLHLTPFHARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A3B3TCS4_BCL2-01      SEMHEELHITPSTAQRRFTAVIEELFSDGVNWGRIVAFLEFGGTMCVESV
A0A0U3DHY6_BCL2-01      AEMSGQLHFTPSTAQXRFTAVIDELFSDGVNWGRIVAFFEFGGTMCVESV
A0A3P9AAB2_BCL2-01      AEMSGQLHITPSTAHGRFTAVIDELFSDGVNWGRIVAFLEFGGTMCVESV
F6YNL8_BCL2-01          DEMSGQLHLTPVTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A218UQA0_BCL2-01      SQMSGQLHLTPFTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESV
Q00709_BCL2-01          AQMSGQLHLTPFTAHGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A493T1X3_BCL2-01      AQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESV
U3KEW4_BCL2-01          AQMSGQLHLTPFTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESV
G3WZW9_BCL2-01          DEMSGQLHLTPVTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A452R110_BCL2-02      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
E2QWA1_BCL2-01          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
G1LIC9_BCL2-01          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A452R110_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
M3YYK3_BCL2-01          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A2K6R2I5_BCL2-02      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A2R9APW6_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
M3X1R9_BCL2-02          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
G3SLZ1_BCL2-01          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
Q75SV7_BCL2-01          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
M3X1R9_BCL2-01          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
Q8I008_BCL2-01          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVEGV
A0A076FU27_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVICVESV
A0A4P8GLJ2_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
F6R2C4_BCL2-01          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
O02718_BCL2-01          AEMSSQLHLTPFTARERFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A076FZV9_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A452EV13_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A250YD83_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A9QXG9_BCL2-01          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A2K5NZS5_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A0D9S017_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A2K6CIX3_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A2K5XRD4_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A2K6KHG1_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A2K6R2I5_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A2K5HK49_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
G3QES9_BCL2-01          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
H2QEM8_BCL2-01          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A2I3GZF9_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A2K6UEL3_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
G3WZW9_BCL2-02          DEMSGQLHLTPVTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
G3SLZ1_BCL2-02          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A452T603_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
X4ZGI8_BCL2-01          EEMSHQMTFSPSAAQRSFLAVAEELFRDGVNWGRIVAFFEFGGTMCVESF
B9ZYL7_BCL2-01          RQISGLLHLTPSTVRVRFATVVEELFHDGVNWGRIVAFFEFGGVMCVEIV
Q564A4_BCL2-01          EEMSQQMVFNPNSAQRSFLTVAEELFRDGVNWGRIIAFFEFGGTMCVESV
H9GPE7_BCL2-01          AQMSGQLHLTPSTARSRFVAVVEELFQDGVNWGRIVAFFEFGGMLCVESV
A0A452I9V7_BCL2-01      AQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESV
W5N4F7_BCL2-01          AEMSDQLHFTPNTARRKFTAVVEELFRDGVNWGRIVAFFEFGGTMCVESV
K7F5Y3_BCL2-02          AQMSGQLHLTPFTARGRFVAVVEELFRDGINWGRIVAFFEFGGVMCVESV
A0A3Q2HRY3_BCL2-02      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
H0YUX3_BCL2-01          SQMSGQLHLTPFTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESV
K7F5Y3_BCL2-01          AQMSGQLHLTPFTARGRFVAVVEELFRDGINWGRIVAFFEFGGVMCVESV
F1LNV0_BCL2-01          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
P49950_BCL2-01          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVGSV
G1TW27_BCL2-01          AEMSSQLHLTPFHARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A2K5EB04_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A2R8MY14_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
H2NWH5_BCL2-01          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A096MPU7_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A2K5PP81_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
H0WKI0_BCL2-01          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A2K5UDI5_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
P10417_BCL2-01          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
Q7TSN8_BCL2-01          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A3Q2HRY3_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
E2QWA1_BCL2-02          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
A0A2K6G3I7_BCL2-01      AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
Q6R755_BCL2-01          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
Q9JJV8_BCL2-01          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
Q923R6_BCL2-01          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
H0W1T3_BCL2-01          AEMSSQLHLTPFTARGRFAT----LFRDGVNWGRIVAFFEFGGVMCVESV
G1LIC9_BCL2-02          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
I3MVK9_BCL2-01          AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
                                                ** **:*****:**:**** :**   

G1MZW1_BCL2-01          NRE-MSPLVDNIATWMTEYLNRHLHNWIQDNGGW----------------
A0A3P8YNB4_BCL2-01      NKE-MTSQVDHIAGWMTEYLNGPLHSWIQENGGW----------------
A0A3P8WUE9_BCL2-01      AKEDLTPQVEQVVDWMTEYLNGPLNIWIKENGGW----------------
A0A3B4A3G8_BCL2-01      SKEDMSSQVDNIADWMTEYLNGTLSSWIQDNGGW----------------
A0A3Q3G1D7_BCL2-01      SKQEMTSQVDNIAEWMTEYLNGPLNSWIQDNGGW----------------
A0A3Q2XQX2_BCL2-02      TKEDMTSQVDNIAEWMTEYLNGPLGSWIQDNGGW----------------
A0A3Q2XQX2_BCL2-01      TKEDMTSQVDNIAEWMTEYLNGPLGSWIQDNGGW----------------
A0A3Q3B0R2_BCL2-01      SREEMTPQVDHIAEWMTEYLNGPLNSWIEDNGGW----------------
A0A3Q2PN77_BCL2-01      SKEGMSSQVDNIAEWMTEYLNGPLGSWIQDNGGW----------------
A0A3P9J8Y9_BCL2-01      SNEEMSTQVASIAEWMTEYLNGPLNSWIEENGGW----------------
A0A3Q0S5Z7_BCL2-01      SNEGMTSQVDNIAEWMTEYLNGPLNSWIQDNGGW----------------
A0A3P8QVM8_BCL2-01      SNEGMSSQVDNIADWMTEYLNGPLNSWIQDNGGW----------------
A0A3P9DIG5_BCL2-01      SNEGMSSQVDNIADWMTEYLNGPLNSWIQDNGGW----------------
A0A3Q2UYW8_BCL2-01      SNEGMSSQVDNIADWMTEYLNGPLNSWIQDNGGW----------------
A0A3B4G3K4_BCL2-01      SNEGMSSQVDNIADWMTEYLNGPLNSWIQDNGGW----------------
A0A2U9BJ09_BCL2-01      DTEEMTSQVDNIAEWMTEYLNGPLNSWIMDNGGW----------------
A0A3Q1I5N1_BCL2-01      SKEEMTPQVNNIAEWMTEYLNGPLHSWIQDNGGW----------------
A0A3Q3K1K1_BCL2-01      AKEEMTPQVDKIAEWMTEYLNGPLNSWIQENGGW----------------
A0A3Q3MEY1_BCL2-01      AKEEMTSQVDNIAEWMTEYLNGPLNSWIQDNGGW----------------
A0A1X9JZA1_BCL2-01      AKEEMAAQVNNIAEWMTEYLNGPLNSWIQDNGGW----------------
A0A4D6FTA2_BCL2-01      AKEEMTPQVDNIAEWMTEYLNGPLNSWIQDNGGW----------------
A0A3Q1FLK7_BCL2-01      AKEEMTSQVDNIAEWMTEYLNGPLNSWIQDNGGW----------------
A0A3Q1B8C3_BCL2-01      AKEEMTSQVDNIAEWMTEYLNGPLNSWIQDNGGW----------------
A0A3P8S9L3_BCL2-01      AKEEMTSQVDNIAEWMTEYLNGPLNSWIQDNGGW----------------
A0A3B5BBQ0_BCL2-01      AKEEMTSQVDNIAEWMTEYLNGPLNSWIQDNGGW----------------
A0A3B4TX71_BCL2-01      AKEEMTSQVDNIVEWMTEYLNGPLNSWIKDNGGW----------------
A0A3B4YAG2_BCL2-01      AKEEMTSQVDNIVEWMTEYLNGPLNSWIKDNGGW----------------
G1TW27_BCL2-02          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGWADKSPWISGCLCTSRR
A0A3B3TCS4_BCL2-01      NRE-MTSQVDNIAHWMTEYLNGPLHNWIQENGGW----------------
A0A0U3DHY6_BCL2-01      NRE-MTSQVDNIALWMTEYLNGPLQNWIQENGGW----------------
A0A3P9AAB2_BCL2-01      NRE-MTPQVNNIVHWMTEYLNGPLQNWIQENGGW----------------
F6YNL8_BCL2-01          NRE-MSPLVDSIALWMTEYLNRHLHTWIQDNGGW----------------
A0A218UQA0_BCL2-01      NRE-MFPLVDNIATWMTEYLNRHLHNWIQDNGGW----------------
Q00709_BCL2-01          NRE-MSPLVDNIATWMTEYLNRHLHNWIQDNGGW----------------
A0A493T1X3_BCL2-01      NRE-MSPLVDSIAAWMTEYLNRHLHNWIQDNGGW----------------
U3KEW4_BCL2-01          NRE-MSPLVDSIAAWMTEYLNRHLHNWIQDNGGW----------------
G3WZW9_BCL2-01          NRE-MSPLVDSIALWMTEYLNRHLHNWIQDNGGW----------------
A0A452R110_BCL2-02      NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
E2QWA1_BCL2-01          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
G1LIC9_BCL2-01          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
A0A452R110_BCL2-01      NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
M3YYK3_BCL2-01          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
A0A2K6R2I5_BCL2-02      NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
A0A2R9APW6_BCL2-01      NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
M3X1R9_BCL2-02          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
G3SLZ1_BCL2-01          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
Q75SV7_BCL2-01          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
M3X1R9_BCL2-01          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
Q8I008_BCL2-01          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
A0A076FU27_BCL2-01      NRE-MSPLVDSIALWMTEYLNRHLHAWIQDNGGW----------------
A0A4P8GLJ2_BCL2-01      NRE-MSPLVDSIALWMTEYLNRHLHTWIQDNGGW----------------
F6R2C4_BCL2-01          NRE-MSPLVDSIALWMTEYLNRHLHTWIQDNGGW----------------
O02718_BCL2-01          NRE-MSPLVDSIALWMTEYLNRHLHTWIQDNGGW----------------
A0A076FZV9_BCL2-01      NRE-MSPLVDSIALWMTEYLNRHLHAWIQDNGGW----------------
A0A452EV13_BCL2-01      NRE-MSPLVDSIALWMTEYLNRHLHAWIQDNGGW----------------
A0A250YD83_BCL2-01      NRE-MSPLVDNIALWMIEYLNRHLHTWIQDNGGW----------------
A9QXG9_BCL2-01          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
A0A2K5NZS5_BCL2-01      NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
A0A0D9S017_BCL2-01      NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
A0A2K6CIX3_BCL2-01      NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
A0A2K5XRD4_BCL2-01      NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
A0A2K6KHG1_BCL2-01      NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
A0A2K6R2I5_BCL2-01      NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
A0A2K5HK49_BCL2-01      NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
G3QES9_BCL2-01          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
H2QEM8_BCL2-01          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
A0A2I3GZF9_BCL2-01      NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
A0A2K6UEL3_BCL2-01      NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
G3WZW9_BCL2-02          NRE-MSPLVDSIALWMTEYLNRHLHNWIQDNGGW----------------
G3SLZ1_BCL2-02          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
A0A452T603_BCL2-01      NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
X4ZGI8_BCL2-01          NRE-MASQVDNIAHWMTDYLNGPLENWIEENGGW----------------
B9ZYL7_BCL2-01          NRE-MSPLVDSIVGWMTEYLNRHLQNWIQEQ-------------------
Q564A4_BCL2-01          NRE-MASQVDNIAHWMTDYLNGPLENWIEENGGW----------------
H9GPE7_BCL2-01          SRE-MSPLVDNIATWMTEYLNQYLRNWIQENGGW----------------
A0A452I9V7_BCL2-01      NRE-MSPLVDSIAVWMTEYLNRHLHNWIQDNGGW----------------
W5N4F7_BCL2-01          NRE-MTSQVDNIANWMTEYLNGPLQNWIQENGGW----------------
K7F5Y3_BCL2-02          NRE-MSPLVDSIAVWMTEYLNRHLHNWIQDNGGW----------------
A0A3Q2HRY3_BCL2-02      NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
H0YUX3_BCL2-01          NRE-MFPLVDNIATWMTEYLNRHLHNWIQDNGGW----------------
K7F5Y3_BCL2-01          NRE-MSPLVDSIAVWMTEYLNRHLHNWIQDNGGW----------------
F1LNV0_BCL2-01          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
P49950_BCL2-01          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
G1TW27_BCL2-01          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
A0A2K5EB04_BCL2-01      NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
A0A2R8MY14_BCL2-01      NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
H2NWH5_BCL2-01          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
A0A096MPU7_BCL2-01      NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
A0A2K5PP81_BCL2-01      NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
H0WKI0_BCL2-01          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
A0A2K5UDI5_BCL2-01      NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
P10417_BCL2-01          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
Q7TSN8_BCL2-01          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
A0A3Q2HRY3_BCL2-01      NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
E2QWA1_BCL2-02          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
A0A2K6G3I7_BCL2-01      NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
Q6R755_BCL2-01          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
Q9JJV8_BCL2-01          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
Q923R6_BCL2-01          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
H0W1T3_BCL2-01          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
G1LIC9_BCL2-02          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
I3MVK9_BCL2-01          NRE-MSPLVDNIALWMTEYLNRHLHTWIQDNGGW----------------
                          : : . *  :. ** :***  *  ** ::                   

G1MZW1_BCL2-01          --------------------------------------------------
A0A3P8YNB4_BCL2-01      --------------------------------------------------
A0A3P8WUE9_BCL2-01      --------------------------------------------------
A0A3B4A3G8_BCL2-01      --------------------------------------------------
A0A3Q3G1D7_BCL2-01      --------------------------------------------------
A0A3Q2XQX2_BCL2-02      --------------------------------------------------
A0A3Q2XQX2_BCL2-01      --------------------------------------------------
A0A3Q3B0R2_BCL2-01      --------------------------------------------------
A0A3Q2PN77_BCL2-01      --------------------------------------------------
A0A3P9J8Y9_BCL2-01      --------------------------------------------------
A0A3Q0S5Z7_BCL2-01      --------------------------------------------------
A0A3P8QVM8_BCL2-01      --------------------------------------------------
A0A3P9DIG5_BCL2-01      --------------------------------------------------
A0A3Q2UYW8_BCL2-01      --------------------------------------------------
A0A3B4G3K4_BCL2-01      --------------------------------------------------
A0A2U9BJ09_BCL2-01      --------------------------------------------------
A0A3Q1I5N1_BCL2-01      --------------------------------------------------
A0A3Q3K1K1_BCL2-01      --------------------------------------------------
A0A3Q3MEY1_BCL2-01      --------------------------------------------------
A0A1X9JZA1_BCL2-01      --------------------------------------------------
A0A4D6FTA2_BCL2-01      --------------------------------------------------
A0A3Q1FLK7_BCL2-01      --------------------------------------------------
A0A3Q1B8C3_BCL2-01      --------------------------------------------------
A0A3P8S9L3_BCL2-01      --------------------------------------------------
A0A3B5BBQ0_BCL2-01      --------------------------------------------------
A0A3B4TX71_BCL2-01      --------------------------------------------------
A0A3B4YAG2_BCL2-01      --------------------------------------------------
G1TW27_BCL2-02          ATPGAHSLTEGSATSSASLYSAQHREAWHGFCWNEKIGRAALDNSTAKHC
A0A3B3TCS4_BCL2-01      --------------------------------------------------
A0A0U3DHY6_BCL2-01      --------------------------------------------------
A0A3P9AAB2_BCL2-01      --------------------------------------------------
F6YNL8_BCL2-01          --------------------------------------------------
A0A218UQA0_BCL2-01      --------------------------------------------------
Q00709_BCL2-01          --------------------------------------------------
A0A493T1X3_BCL2-01      --------------------------------------------------
U3KEW4_BCL2-01          --------------------------------------------------
G3WZW9_BCL2-01          --------------------------------------------------
A0A452R110_BCL2-02      --------------------------------------------------
E2QWA1_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-01          --------------------------------------------------
A0A452R110_BCL2-01      --------------------------------------------------
M3YYK3_BCL2-01          --------------------------------------------------
A0A2K6R2I5_BCL2-02      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
M3X1R9_BCL2-02          --------------------------------------------------
G3SLZ1_BCL2-01          --------------------------------------------------
Q75SV7_BCL2-01          --------------------------------------------------
M3X1R9_BCL2-01          --------------------------------------------------
Q8I008_BCL2-01          --------------------------------------------------
A0A076FU27_BCL2-01      --------------------------------------------------
A0A4P8GLJ2_BCL2-01      --------------------------------------------------
F6R2C4_BCL2-01          --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A076FZV9_BCL2-01      --------------------------------------------------
A0A452EV13_BCL2-01      --------------------------------------------------
A0A250YD83_BCL2-01      --------------------------------------------------
A9QXG9_BCL2-01          --------------------------------------------------
A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A0D9S017_BCL2-01      --------------------------------------------------
A0A2K6CIX3_BCL2-01      --------------------------------------------------
A0A2K5XRD4_BCL2-01      --------------------------------------------------
A0A2K6KHG1_BCL2-01      --------------------------------------------------
A0A2K6R2I5_BCL2-01      --------------------------------------------------
A0A2K5HK49_BCL2-01      --------------------------------------------------
G3QES9_BCL2-01          --------------------------------------------------
H2QEM8_BCL2-01          --------------------------------------------------
A0A2I3GZF9_BCL2-01      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
G3WZW9_BCL2-02          --------------------------------------------------
G3SLZ1_BCL2-02          --------------------------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
B9ZYL7_BCL2-01          --------------------------------------------------
Q564A4_BCL2-01          --------------------------------------------------
H9GPE7_BCL2-01          --------------------------------------------------
A0A452I9V7_BCL2-01      --------------------------------------------------
W5N4F7_BCL2-01          --------------------------------------------------
K7F5Y3_BCL2-02          --------------------------------------------------
A0A3Q2HRY3_BCL2-02      --------------------------------------------------
H0YUX3_BCL2-01          --------------------------------------------------
K7F5Y3_BCL2-01          --------------------------------------------------
F1LNV0_BCL2-01          --------------------------------------------------
P49950_BCL2-01          --------------------------------------------------
G1TW27_BCL2-01          --------------------------------------------------
A0A2K5EB04_BCL2-01      --------------------------------------------------
A0A2R8MY14_BCL2-01      --------------------------------------------------
H2NWH5_BCL2-01          --------------------------------------------------
A0A096MPU7_BCL2-01      --------------------------------------------------
A0A2K5PP81_BCL2-01      --------------------------------------------------
H0WKI0_BCL2-01          --------------------------------------------------
A0A2K5UDI5_BCL2-01      --------------------------------------------------
P10417_BCL2-01          --------------------------------------------------
Q7TSN8_BCL2-01          --------------------------------------------------
A0A3Q2HRY3_BCL2-01      --------------------------------------------------
E2QWA1_BCL2-02          --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
Q6R755_BCL2-01          --------------------------------------------------
Q9JJV8_BCL2-01          --------------------------------------------------
Q923R6_BCL2-01          --------------------------------------------------
H0W1T3_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-02          --------------------------------------------------
I3MVK9_BCL2-01          --------------------------------------------------
                                                                          

G1MZW1_BCL2-01          --------------------------------------------------
A0A3P8YNB4_BCL2-01      --------------------------------------------------
A0A3P8WUE9_BCL2-01      --------------------------------------------------
A0A3B4A3G8_BCL2-01      --------------------------------------------------
A0A3Q3G1D7_BCL2-01      --------------------------------------------------
A0A3Q2XQX2_BCL2-02      --------------------------------------------------
A0A3Q2XQX2_BCL2-01      --------------------------------------------------
A0A3Q3B0R2_BCL2-01      --------------------------------------------------
A0A3Q2PN77_BCL2-01      --------------------------------------------------
A0A3P9J8Y9_BCL2-01      --------------------------------------------------
A0A3Q0S5Z7_BCL2-01      --------------------------------------------------
A0A3P8QVM8_BCL2-01      --------------------------------------------------
A0A3P9DIG5_BCL2-01      --------------------------------------------------
A0A3Q2UYW8_BCL2-01      --------------------------------------------------
A0A3B4G3K4_BCL2-01      --------------------------------------------------
A0A2U9BJ09_BCL2-01      --------------------------------------------------
A0A3Q1I5N1_BCL2-01      --------------------------------------------------
A0A3Q3K1K1_BCL2-01      --------------------------------------------------
A0A3Q3MEY1_BCL2-01      --------------------------------------------------
A0A1X9JZA1_BCL2-01      --------------------------------------------------
A0A4D6FTA2_BCL2-01      --------------------------------------------------
A0A3Q1FLK7_BCL2-01      --------------------------------------------------
A0A3Q1B8C3_BCL2-01      --------------------------------------------------
A0A3P8S9L3_BCL2-01      --------------------------------------------------
A0A3B5BBQ0_BCL2-01      --------------------------------------------------
A0A3B4TX71_BCL2-01      --------------------------------------------------
A0A3B4YAG2_BCL2-01      --------------------------------------------------
G1TW27_BCL2-02          GRRFGLHTKAAKVLIAFSVIAKKALNSSLHVFRMTDFCSASSEHSASHGK
A0A3B3TCS4_BCL2-01      --------------------------------------------------
A0A0U3DHY6_BCL2-01      --------------------------------------------------
A0A3P9AAB2_BCL2-01      --------------------------------------------------
F6YNL8_BCL2-01          --------------------------------------------------
A0A218UQA0_BCL2-01      --------------------------------------------------
Q00709_BCL2-01          --------------------------------------------------
A0A493T1X3_BCL2-01      --------------------------------------------------
U3KEW4_BCL2-01          --------------------------------------------------
G3WZW9_BCL2-01          --------------------------------------------------
A0A452R110_BCL2-02      --------------------------------------------------
E2QWA1_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-01          --------------------------------------------------
A0A452R110_BCL2-01      --------------------------------------------------
M3YYK3_BCL2-01          --------------------------------------------------
A0A2K6R2I5_BCL2-02      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
M3X1R9_BCL2-02          --------------------------------------------------
G3SLZ1_BCL2-01          --------------------------------------------------
Q75SV7_BCL2-01          --------------------------------------------------
M3X1R9_BCL2-01          --------------------------------------------------
Q8I008_BCL2-01          --------------------------------------------------
A0A076FU27_BCL2-01      --------------------------------------------------
A0A4P8GLJ2_BCL2-01      --------------------------------------------------
F6R2C4_BCL2-01          --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A076FZV9_BCL2-01      --------------------------------------------------
A0A452EV13_BCL2-01      --------------------------------------------------
A0A250YD83_BCL2-01      --------------------------------------------------
A9QXG9_BCL2-01          --------------------------------------------------
A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A0D9S017_BCL2-01      --------------------------------------------------
A0A2K6CIX3_BCL2-01      --------------------------------------------------
A0A2K5XRD4_BCL2-01      --------------------------------------------------
A0A2K6KHG1_BCL2-01      --------------------------------------------------
A0A2K6R2I5_BCL2-01      --------------------------------------------------
A0A2K5HK49_BCL2-01      --------------------------------------------------
G3QES9_BCL2-01          --------------------------------------------------
H2QEM8_BCL2-01          --------------------------------------------------
A0A2I3GZF9_BCL2-01      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
G3WZW9_BCL2-02          --------------------------------------------------
G3SLZ1_BCL2-02          --------------------------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
B9ZYL7_BCL2-01          --------------------------------------------------
Q564A4_BCL2-01          --------------------------------------------------
H9GPE7_BCL2-01          --------------------------------------------------
A0A452I9V7_BCL2-01      --------------------------------------------------
W5N4F7_BCL2-01          --------------------------------------------------
K7F5Y3_BCL2-02          --------------------------------------------------
A0A3Q2HRY3_BCL2-02      --------------------------------------------------
H0YUX3_BCL2-01          --------------------------------------------------
K7F5Y3_BCL2-01          --------------------------------------------------
F1LNV0_BCL2-01          --------------------------------------------------
P49950_BCL2-01          --------------------------------------------------
G1TW27_BCL2-01          --------------------------------------------------
A0A2K5EB04_BCL2-01      --------------------------------------------------
A0A2R8MY14_BCL2-01      --------------------------------------------------
H2NWH5_BCL2-01          --------------------------------------------------
A0A096MPU7_BCL2-01      --------------------------------------------------
A0A2K5PP81_BCL2-01      --------------------------------------------------
H0WKI0_BCL2-01          --------------------------------------------------
A0A2K5UDI5_BCL2-01      --------------------------------------------------
P10417_BCL2-01          --------------------------------------------------
Q7TSN8_BCL2-01          --------------------------------------------------
A0A3Q2HRY3_BCL2-01      --------------------------------------------------
E2QWA1_BCL2-02          --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
Q6R755_BCL2-01          --------------------------------------------------
Q9JJV8_BCL2-01          --------------------------------------------------
Q923R6_BCL2-01          --------------------------------------------------
H0W1T3_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-02          --------------------------------------------------
I3MVK9_BCL2-01          --------------------------------------------------
                                                                          

G1MZW1_BCL2-01          --------------------------DAFVELYGT-----------SMRP
A0A3P8YNB4_BCL2-01      --------------------------EAFVELYDR-----------QRDS
A0A3P8WUE9_BCL2-01      --------------------------DAFVELYDR-----------QGES
A0A3B4A3G8_BCL2-01      --------------------------EAFVELYDR-----------QRDS
A0A3Q3G1D7_BCL2-01      --------------------------DAFVELYDR-----------QRDS
A0A3Q2XQX2_BCL2-02      --------------------------DAFVELYDR-----------QRDS
A0A3Q2XQX2_BCL2-01      --------------------------DAFVELYDR-----------QRDS
A0A3Q3B0R2_BCL2-01      --------------------------DAFVELYDR-----------HKES
A0A3Q2PN77_BCL2-01      --------------------------DAFVELYDR-----------QKES
A0A3P9J8Y9_BCL2-01      --------------------------DAFVELYDR-----------QKET
A0A3Q0S5Z7_BCL2-01      --------------------------DAFVELYGR-----------QRES
A0A3P8QVM8_BCL2-01      --------------------------DAFVELYDR-----------QRDS
A0A3P9DIG5_BCL2-01      --------------------------DAFVELYDR-----------QRDS
A0A3Q2UYW8_BCL2-01      --------------------------DAFVELYDR-----------QRDS
A0A3B4G3K4_BCL2-01      --------------------------DAFVELYDR-----------QRDS
A0A2U9BJ09_BCL2-01      --------------------------DAFVELYDR-----------HGES
A0A3Q1I5N1_BCL2-01      --------------------------DAFVDLYDR-----------QRES
A0A3Q3K1K1_BCL2-01      --------------------------DAFVELYDR-----------QRES
A0A3Q3MEY1_BCL2-01      --------------------------DAFVEMYDR-----------QRES
A0A1X9JZA1_BCL2-01      --------------------------DAFVELYDR-----------QRDS
A0A4D6FTA2_BCL2-01      --------------------------DAFVELYDR-----------QRDS
A0A3Q1FLK7_BCL2-01      --------------------------DAFVELYDR-----------QRDS
A0A3Q1B8C3_BCL2-01      --------------------------DAFVELYDR-----------QRDS
A0A3P8S9L3_BCL2-01      --------------------------DAFVELYDR-----------QRDS
A0A3B5BBQ0_BCL2-01      --------------------------DAFVELYDR-----------QRDS
A0A3B4TX71_BCL2-01      --------------------------DAFVELYDR-----------QRES
A0A3B4YAG2_BCL2-01      --------------------------DAFVELYDR-----------QRES
G1TW27_BCL2-02          ERLDLRGKTQKTDDGSQLVLQKEFPVNCFGTVEGQKQSKDVLPCIYIIYE
A0A3B3TCS4_BCL2-01      --------------------------DAFVEIYGQ-----------QRGS
A0A0U3DHY6_BCL2-01      --------------------------DAFVEIYEQ-----------QR--
A0A3P9AAB2_BCL2-01      --------------------------DAFVEIYGQ-----------KRGS
F6YNL8_BCL2-01          --------------------------VGA---------------------
A0A218UQA0_BCL2-01      --------------------------DAFVELYGN-----------NMRP
Q00709_BCL2-01          --------------------------DAFVELYGN-----------SMRP
A0A493T1X3_BCL2-01      --------------------------DAFVELYGN-----------SMRP
U3KEW4_BCL2-01          --------------------------DAFVELYGN-----------SMRP
G3WZW9_BCL2-01          --------------------------GTKAICMGT-----------S--G
A0A452R110_BCL2-02      --------------------------AH----------------------
E2QWA1_BCL2-01          --------------------------DAFVELYGP-----------TMQP
G1LIC9_BCL2-01          --------------------------DAFVELYGP-----------SMQP
A0A452R110_BCL2-01      --------------------------DAFVELYGP-----------SMQP
M3YYK3_BCL2-01          --------------------------PAPAPHEGP-----------AARP
A0A2K6R2I5_BCL2-02      --------------------------RTMC--------------------
A0A2R9APW6_BCL2-01      --------------------------DAFVELYGP-----------SMRP
M3X1R9_BCL2-02          --------------------------LILL-------------------P
G3SLZ1_BCL2-01          --------------------------DAFVELYGP-----------NMRP
Q75SV7_BCL2-01          --------------------------DAFVELYGP-----------TMQP
M3X1R9_BCL2-01          --------------------------DAFVELYGP-----------SMQP
Q8I008_BCL2-01          --------------------------DAFVELYGP-----------SMQP
A0A076FU27_BCL2-01      --------------------------DAFVELYGP-----------SMRP
A0A4P8GLJ2_BCL2-01      --------------------------DAFVELYGP-----------SMRP
F6R2C4_BCL2-01          --------------------------DAFVELYGP-----------SMRP
O02718_BCL2-01          --------------------------DAFVELYGP-----------SMRP
A0A076FZV9_BCL2-01      --------------------------DAFVELYGP-----------SMRP
A0A452EV13_BCL2-01      --------------------------DAFVELYGP-----------SMRP
A0A250YD83_BCL2-01      --------------------------DAFVELYGP-----------SVRP
A9QXG9_BCL2-01          --------------------------DAFVELYGP-----------SMRP
A0A2K5NZS5_BCL2-01      --------------------------DAFVELYGP-----------SMRP
A0A0D9S017_BCL2-01      --------------------------DAFVELYGP-----------SMRP
A0A2K6CIX3_BCL2-01      --------------------------DAFVELYGP-----------SMRP
A0A2K5XRD4_BCL2-01      --------------------------DAFVELYGP-----------SMRP
A0A2K6KHG1_BCL2-01      --------------------------DAFVELYGP-----------SMRP
A0A2K6R2I5_BCL2-01      --------------------------DAFVELYGP-----------SMRP
A0A2K5HK49_BCL2-01      --------------------------DAFVELYGP-----------SMWP
G3QES9_BCL2-01          --------------------------DAFVELYGP-----------SMRP
H2QEM8_BCL2-01          --------------------------DAFVELYGP-----------SMRP
A0A2I3GZF9_BCL2-01      --------------------------DAFVELYGP-----------SMRP
A0A2K6UEL3_BCL2-01      --------------------------DAFVELYGP-----------SMRP
G3WZW9_BCL2-02          --------------------------VGVSA-------------------
G3SLZ1_BCL2-02          --------------------------VGACVVE-----------------
A0A452T603_BCL2-01      --------------------------VGARPLECA-----------SGLH
X4ZGI8_BCL2-01          --------------------------DAFVELYSQ-----------QRDP
B9ZYL7_BCL2-01          --------------------------DAFVELYNS-----------NIQP
Q564A4_BCL2-01          --------------------------DAFVEMYGQ-----------QRDS
H9GPE7_BCL2-01          --------------------------------------------------
A0A452I9V7_BCL2-01      --------------------------------------------------
W5N4F7_BCL2-01          --------------------------DAFVELYGR-----------QRGS
K7F5Y3_BCL2-02          --------------------------AGAVSVL-----------------
A0A3Q2HRY3_BCL2-02      --------------------------QLCQAPTGSQEMFSGGWTIHSGSP
H0YUX3_BCL2-01          --------------------------DAFVELYGN-----------NMRP
K7F5Y3_BCL2-01          --------------------------DAFVELYGS-----------NMRP
F1LNV0_BCL2-01          --------------------------DAFVELYGP-----------SMRP
P49950_BCL2-01          --------------------------DAFVELYGP-----------SMRP
G1TW27_BCL2-01          --------------------------DAFVELYGP-----------SVRP
A0A2K5EB04_BCL2-01      --------------------------DAFVELYGP-----------SMRP
A0A2R8MY14_BCL2-01      --------------------------DAFVELYGP-----------SMRP
H2NWH5_BCL2-01          --------------------------DAFVELYGP-----------SMRP
A0A096MPU7_BCL2-01      --------------------------DAFVELYGP-----------SMRP
A0A2K5PP81_BCL2-01      --------------------------DAFVELYGP-----------SMRP
H0WKI0_BCL2-01          --------------------------DAFVELYGP-----------SMRP
A0A2K5UDI5_BCL2-01      --------------------------DAFVELYGP-----------SMRP
P10417_BCL2-01          --------------------------DAFVELYGP-----------SMRP
Q7TSN8_BCL2-01          --------------------------DAFVELYGP-----------SMRP
A0A3Q2HRY3_BCL2-01      --------------------------DAFVELYGP-----------SMRP
E2QWA1_BCL2-02          --------------------------DAFVELYGP-----------TMQP
A0A2K6G3I7_BCL2-01      --------------------------DAFVELYGP-----------SMRP
Q6R755_BCL2-01          --------------------------DAFVELYGP-----------TMQP
Q9JJV8_BCL2-01          --------------------------DAFVELYGP-----------SVRP
Q923R6_BCL2-01          --------------------------DAFVELYGP-----------SVRP
H0W1T3_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-02          --------------------------------------------------
I3MVK9_BCL2-01          --------------------------------------------------
                                                                          

G1MZW1_BCL2-01          LFDF------S-WISLKTILSLVLVG-----ACITLGAY-LGHK------
A0A3P8YNB4_BCL2-01      VF-C------S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK------
A0A3P8WUE9_BCL2-01      AFSC------S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK------
A0A3B4A3G8_BCL2-01      VFSC------S-WPSIKTVFGLAAIGA----ASLTIGAY-LSQK------
A0A3Q3G1D7_BCL2-01      AFCS------S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK------
A0A3Q2XQX2_BCL2-02      VFSC------T-WPSIKTVFGLAALGA----ASLTIGAY-LTQK------
A0A3Q2XQX2_BCL2-01      VFSC------T-WPSIKTVFGLAALGA----ASLTIGAY-LTQK------
A0A3Q3B0R2_BCL2-01      VFSC------Y-WPSIKTVFGLAALGA----ASITIGAY-LTQKMPLTPQ
A0A3Q2PN77_BCL2-01      IFSC------Y-WPSIKTVFGLAALGA----ASITIGAY-LAQK------
A0A3P9J8Y9_BCL2-01      VFSC------Y-WPSIKTVFGLAALGA----ASLTIGAY-LAQK------
A0A3Q0S5Z7_BCL2-01      VFSC------S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK------
A0A3P8QVM8_BCL2-01      VFSC------S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK------
A0A3P9DIG5_BCL2-01      VFSC------S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK------
A0A3Q2UYW8_BCL2-01      VFSC------S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK------
A0A3B4G3K4_BCL2-01      VFSC------S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK------
A0A2U9BJ09_BCL2-01      VFSC------S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK------
A0A3Q1I5N1_BCL2-01      VFSC------S-WSSIKTVFGLAALGA----ASLTIGAY-LAQK------
A0A3Q3K1K1_BCL2-01      VFSC------S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK------
A0A3Q3MEY1_BCL2-01      VFSC------S-WPSIKTVFGLAALGA----ASITIGAY-LTQK------
A0A1X9JZA1_BCL2-01      VFSC------S-WPSIKTVFGVAALGA----ASLTIGAY-LTQK------
A0A4D6FTA2_BCL2-01      VFSC------S-WPSIKTVFGMAALGA----ASLTIGAY-LTQK------
A0A3Q1FLK7_BCL2-01      VFSC------S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK------
A0A3Q1B8C3_BCL2-01      VFSC------S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK------
A0A3P8S9L3_BCL2-01      VFSC------S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK------
A0A3B5BBQ0_BCL2-01      VFSC------S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK------
A0A3B4TX71_BCL2-01      VFSC------S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK------
A0A3B4YAG2_BCL2-01      VFSC------S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK------
G1TW27_BCL2-02          AFSH------LEVLLYVLQWDLASCQLQFEPISFCIGFCVQGNLVSL---
A0A3B3TCS4_BCL2-01      VMA-------CFWPYLKTVFGLAALGA----VGVTISAY-FTKK------
A0A0U3DHY6_BCL2-01      ISH-------S-WPYLKTVFGLAALGA----VGVTIGAL-FTQK------
A0A3P9AAB2_BCL2-01      LFH-------S-WPFLKTMFSLAALGA----AGVTIGAM-FTQK------
F6YNL8_BCL2-01          --------------------------------------------------
A0A218UQA0_BCL2-01      LFDF------S-WISLKTILSLVLVG-----ACITLGAY-LGHK------
Q00709_BCL2-01          LFDF------S-WISLKTILSLVLVG-----ACITLGAY-LGHK------
A0A493T1X3_BCL2-01      LFDF------S-WISLKTILSLVLVG-----ACITLGAY-LGHK------
U3KEW4_BCL2-01          LFDF------S-WISLKTILSLVLVG-----ACITLGAY-LGHK------
G3WZW9_BCL2-01          PFQV------S---------------------------------------
A0A452R110_BCL2-02      --------------------------------------------------
E2QWA1_BCL2-01          LFDF------S-WLSLKALLSLALVG-----ACITLGAY-LGHK------
G1LIC9_BCL2-01          LFDF------S-WLSLKALLSLALVG-----ACITLGAY-LGHK------
A0A452R110_BCL2-01      LFDF------S-WLSLKALLSLALVG-----ACITLGAY-LGHK------
M3YYK3_BCL2-01          IVDD------SYWPKVFSLLA-----------------------------
A0A2K6R2I5_BCL2-02      ----------T-WCRFR------------------------GCD------
A0A2R9APW6_BCL2-01      LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
M3X1R9_BCL2-02          RTSY------E-LKSSRALREDVRIS-----PSFLFKD------------
G3SLZ1_BCL2-01          LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
Q75SV7_BCL2-01          LFDF------S-WLSLKALLSLALVG-----ACITLGAY-LGHK------
M3X1R9_BCL2-01          LFDF------S-WLSLKALLSLALVG-----ACITLGAY-LGHK------
Q8I008_BCL2-01          LFDF------S-WLSLKALLSLALVG-----ACITLGAY-LGHK------
A0A076FU27_BCL2-01      LFDF------S-WLSLKALLSLALVG-----ACITLGAY-LGHK------
A0A4P8GLJ2_BCL2-01      LFDF------S-WLSLKALLSLALVG-----ACITLGAY-LGHK------
F6R2C4_BCL2-01          LFDF------S-WLSLKALLSLALVG-----ACITLGAY-LGHK------
O02718_BCL2-01          LFDF------S-WLSLKALLSLALVG-----ACITLGAY-LGHK------
A0A076FZV9_BCL2-01      LFDF------S-WLSLKALLSLALVG-----ACITLGAY-LGHK------
A0A452EV13_BCL2-01      LFDF------S-WLSLKALLSLALVG-----ACITLGAY-LGHK------
A0A250YD83_BCL2-01      LFDF------S-WLSLKTLLSLALVG-----VCITLGAY-LGHK------
A9QXG9_BCL2-01          LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LSHK------
A0A2K5NZS5_BCL2-01      LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
A0A0D9S017_BCL2-01      LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
A0A2K6CIX3_BCL2-01      LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
A0A2K5XRD4_BCL2-01      LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
A0A2K6KHG1_BCL2-01      LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
A0A2K6R2I5_BCL2-01      LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
A0A2K5HK49_BCL2-01      LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
G3QES9_BCL2-01          LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
H2QEM8_BCL2-01          LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
A0A2I3GZF9_BCL2-01      LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
A0A2K6UEL3_BCL2-01      LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
G3WZW9_BCL2-02          --------------------------------------------------
G3SLZ1_BCL2-02          --------------------------------------------------
A0A452T603_BCL2-01      VSNL------RLRIRGWSVGGLLGQG-----QTDEPGK------------
X4ZGI8_BCL2-01          MFH-------P-LSYLTKVLGLAALGL----AGVTIGAF-FAQK------
B9ZYL7_BCL2-01          PFDQ------S-WLSIKTILSLAVVG-----ACITIGGISLATK------
Q564A4_BCL2-01          VFH-------P-FSYLTKVLGLAALGL----AGVTIGAF-FAQK------
H9GPE7_BCL2-01          --------------------------------------------------
A0A452I9V7_BCL2-01      -------------------------------VCVQYFFL-FKLQ------
W5N4F7_BCL2-01          MFSC------S-WPSLKTFFGLAALGA----AGLTVGAY-FTQK------
K7F5Y3_BCL2-02          --------------------------------------------------
A0A3Q2HRY3_BCL2-02      LQNLCVSRAGN-WFSEKKNMTWCLTSDKDVIDRTPIRMY-QGRKSREAEI
H0YUX3_BCL2-01          LFDF------S-WISLKTILSLVLVG-----ACITLGAY-LGHK------
K7F5Y3_BCL2-01          LFDF------S-WISLKTILSLALVG-----ACITLGAY-LGHK------
F1LNV0_BCL2-01          LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
P49950_BCL2-01          LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
G1TW27_BCL2-01          LSDF------S-WVSLKTLFSLALIG-----ACITLGAY-LGHK------
A0A2K5EB04_BCL2-01      LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
A0A2R8MY14_BCL2-01      LFDF------S-WLSLKTLLSLVLVG-----ACITLGAY-LGHK------
H2NWH5_BCL2-01          LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
A0A096MPU7_BCL2-01      LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
A0A2K5PP81_BCL2-01      LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
H0WKI0_BCL2-01          LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
A0A2K5UDI5_BCL2-01      LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
P10417_BCL2-01          LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
Q7TSN8_BCL2-01          LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
A0A3Q2HRY3_BCL2-01      LFDF------S-WLSLKALLSLALVG-----ACITLGAY-LGHK------
E2QWA1_BCL2-02          LFDF------S-WLSLKALLSLALVG-----ACITLGAY-LGHK------
A0A2K6G3I7_BCL2-01      LFDF------S-WLSLKTLLSLALVG-----ACITLGAY-LGHK------
Q6R755_BCL2-01          LFDF------S-WLSLKALLSLALVG-----ACITLGAY-LGHK------
Q9JJV8_BCL2-01          LFDF------S-WLSLKTLLSLALVG-----ACITLGTY-LGHK------
Q923R6_BCL2-01          LFDF------S-WLSLXTLLNLALVG-----ACITLGTY-LGHK------
H0W1T3_BCL2-01          ------------------------VG-----ACLSE--------------
G1LIC9_BCL2-02          ------------------------VG-----ARPLE--------------
I3MVK9_BCL2-01          ------------------------VG-----ARRVE--------------
                                                                          

G1MZW1_BCL2-01          --------------------------------------------------
A0A3P8YNB4_BCL2-01      --------------------------------------------------
A0A3P8WUE9_BCL2-01      --------------------------------------------------
A0A3B4A3G8_BCL2-01      --------------------------------------------------
A0A3Q3G1D7_BCL2-01      --------------------------------------------------
A0A3Q2XQX2_BCL2-02      --------------------------------------------------
A0A3Q2XQX2_BCL2-01      --------------------------------------------------
A0A3Q3B0R2_BCL2-01      RQPSDQIWLSSKPRSENCFPPPAPPCQNRHKSKQQREPEARPREQRMSEV
A0A3Q2PN77_BCL2-01      --------------------------------------------------
A0A3P9J8Y9_BCL2-01      --------------------------------------------------
A0A3Q0S5Z7_BCL2-01      --------------------------------------------------
A0A3P8QVM8_BCL2-01      --------------------------------------------------
A0A3P9DIG5_BCL2-01      --------------------------------------------------
A0A3Q2UYW8_BCL2-01      --------------------------------------------------
A0A3B4G3K4_BCL2-01      --------------------------------------------------
A0A2U9BJ09_BCL2-01      --------------------------------------------------
A0A3Q1I5N1_BCL2-01      --------------------------------------------------
A0A3Q3K1K1_BCL2-01      --------------------------------------------------
A0A3Q3MEY1_BCL2-01      --------------------------------------------------
A0A1X9JZA1_BCL2-01      --------------------------------------------------
A0A4D6FTA2_BCL2-01      --------------------------------------------------
A0A3Q1FLK7_BCL2-01      --------------------------------------------------
A0A3Q1B8C3_BCL2-01      --------------------------------------------------
A0A3P8S9L3_BCL2-01      --------------------------------------------------
A0A3B5BBQ0_BCL2-01      --------------------------------------------------
A0A3B4TX71_BCL2-01      --------------------------------------------------
A0A3B4YAG2_BCL2-01      --------------------------------------------------
G1TW27_BCL2-02          --------------------------------------------------
A0A3B3TCS4_BCL2-01      --------------------------------------------------
A0A0U3DHY6_BCL2-01      --------------------------------------------------
A0A3P9AAB2_BCL2-01      --------------------------------------------------
F6YNL8_BCL2-01          --------------------------------------------------
A0A218UQA0_BCL2-01      --------------------------------------------------
Q00709_BCL2-01          --------------------------------------------------
A0A493T1X3_BCL2-01      --------------------------------------------------
U3KEW4_BCL2-01          --------------------------------------------------
G3WZW9_BCL2-01          --------------------------------------------------
A0A452R110_BCL2-02      --------------------------------------------------
E2QWA1_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-01          --------------------------------------------------
A0A452R110_BCL2-01      --------------------------------------------------
M3YYK3_BCL2-01          --------------------------------------------------
A0A2K6R2I5_BCL2-02      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
M3X1R9_BCL2-02          --------------------------------------------------
G3SLZ1_BCL2-01          --------------------------------------------------
Q75SV7_BCL2-01          --------------------------------------------------
M3X1R9_BCL2-01          --------------------------------------------------
Q8I008_BCL2-01          --------------------------------------------------
A0A076FU27_BCL2-01      --------------------------------------------------
A0A4P8GLJ2_BCL2-01      --------------------------------------------------
F6R2C4_BCL2-01          --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A076FZV9_BCL2-01      --------------------------------------------------
A0A452EV13_BCL2-01      --------------------------------------------------
A0A250YD83_BCL2-01      --------------------------------------------------
A9QXG9_BCL2-01          --------------------------------------------------
A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A0D9S017_BCL2-01      --------------------------------------------------
A0A2K6CIX3_BCL2-01      --------------------------------------------------
A0A2K5XRD4_BCL2-01      --------------------------------------------------
A0A2K6KHG1_BCL2-01      --------------------------------------------------
A0A2K6R2I5_BCL2-01      --------------------------------------------------
A0A2K5HK49_BCL2-01      --------------------------------------------------
G3QES9_BCL2-01          --------------------------------------------------
H2QEM8_BCL2-01          --------------------------------------------------
A0A2I3GZF9_BCL2-01      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
G3WZW9_BCL2-02          --------------------------------------------------
G3SLZ1_BCL2-02          --------------------------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
B9ZYL7_BCL2-01          --------------------------------------------------
Q564A4_BCL2-01          --------------------------------------------------
H9GPE7_BCL2-01          --------------------------------------------------
A0A452I9V7_BCL2-01      --------------------------------------------------
W5N4F7_BCL2-01          --------------------------------------------------
K7F5Y3_BCL2-02          --------------------------------------------------
A0A3Q2HRY3_BCL2-02      QSQCRPPCMLLHLLEIQVPVLFLSE-------------------------
H0YUX3_BCL2-01          --------------------------------------------------
K7F5Y3_BCL2-01          --------------------------------------------------
F1LNV0_BCL2-01          --------------------------------------------------
P49950_BCL2-01          --------------------------------------------------
G1TW27_BCL2-01          --------------------------------------------------
A0A2K5EB04_BCL2-01      --------------------------------------------------
A0A2R8MY14_BCL2-01      --------------------------------------------------
H2NWH5_BCL2-01          --------------------------------------------------
A0A096MPU7_BCL2-01      --------------------------------------------------
A0A2K5PP81_BCL2-01      --------------------------------------------------
H0WKI0_BCL2-01          --------------------------------------------------
A0A2K5UDI5_BCL2-01      --------------------------------------------------
P10417_BCL2-01          --------------------------------------------------
Q7TSN8_BCL2-01          --------------------------------------------------
A0A3Q2HRY3_BCL2-01      --------------------------------------------------
E2QWA1_BCL2-02          --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
Q6R755_BCL2-01          --------------------------------------------------
Q9JJV8_BCL2-01          --------------------------------------------------
Q923R6_BCL2-01          --------------------------------------------------
H0W1T3_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-02          --------------------------------------------------
I3MVK9_BCL2-01          --------------------------------------------------
                                                                          

G1MZW1_BCL2-01          ---
A0A3P8YNB4_BCL2-01      ---
A0A3P8WUE9_BCL2-01      ---
A0A3B4A3G8_BCL2-01      ---
A0A3Q3G1D7_BCL2-01      ---
A0A3Q2XQX2_BCL2-02      ---
A0A3Q2XQX2_BCL2-01      ---
A0A3Q3B0R2_BCL2-01      ESH
A0A3Q2PN77_BCL2-01      ---
A0A3P9J8Y9_BCL2-01      ---
A0A3Q0S5Z7_BCL2-01      ---
A0A3P8QVM8_BCL2-01      ---
A0A3P9DIG5_BCL2-01      ---
A0A3Q2UYW8_BCL2-01      ---
A0A3B4G3K4_BCL2-01      ---
A0A2U9BJ09_BCL2-01      ---
A0A3Q1I5N1_BCL2-01      ---
A0A3Q3K1K1_BCL2-01      ---
A0A3Q3MEY1_BCL2-01      ---
A0A1X9JZA1_BCL2-01      ---
A0A4D6FTA2_BCL2-01      ---
A0A3Q1FLK7_BCL2-01      ---
A0A3Q1B8C3_BCL2-01      ---
A0A3P8S9L3_BCL2-01      ---
A0A3B5BBQ0_BCL2-01      ---
A0A3B4TX71_BCL2-01      ---
A0A3B4YAG2_BCL2-01      ---
G1TW27_BCL2-02          ---
A0A3B3TCS4_BCL2-01      ---
A0A0U3DHY6_BCL2-01      ---
A0A3P9AAB2_BCL2-01      ---
F6YNL8_BCL2-01          ---
A0A218UQA0_BCL2-01      ---
Q00709_BCL2-01          ---
A0A493T1X3_BCL2-01      ---
U3KEW4_BCL2-01          ---
G3WZW9_BCL2-01          ---
A0A452R110_BCL2-02      ---
E2QWA1_BCL2-01          ---
G1LIC9_BCL2-01          ---
A0A452R110_BCL2-01      ---
M3YYK3_BCL2-01          ---
A0A2K6R2I5_BCL2-02      ---
A0A2R9APW6_BCL2-01      ---
M3X1R9_BCL2-02          ---
G3SLZ1_BCL2-01          ---
Q75SV7_BCL2-01          ---
M3X1R9_BCL2-01          ---
Q8I008_BCL2-01          ---
A0A076FU27_BCL2-01      ---
A0A4P8GLJ2_BCL2-01      ---
F6R2C4_BCL2-01          ---
O02718_BCL2-01          ---
A0A076FZV9_BCL2-01      ---
A0A452EV13_BCL2-01      ---
A0A250YD83_BCL2-01      ---
A9QXG9_BCL2-01          ---
A0A2K5NZS5_BCL2-01      ---
A0A0D9S017_BCL2-01      ---
A0A2K6CIX3_BCL2-01      ---
A0A2K5XRD4_BCL2-01      ---
A0A2K6KHG1_BCL2-01      ---
A0A2K6R2I5_BCL2-01      ---
A0A2K5HK49_BCL2-01      ---
G3QES9_BCL2-01          ---
H2QEM8_BCL2-01          ---
A0A2I3GZF9_BCL2-01      ---
A0A2K6UEL3_BCL2-01      ---
G3WZW9_BCL2-02          ---
G3SLZ1_BCL2-02          ---
A0A452T603_BCL2-01      ---
X4ZGI8_BCL2-01          ---
B9ZYL7_BCL2-01          ---
Q564A4_BCL2-01          ---
H9GPE7_BCL2-01          ---
A0A452I9V7_BCL2-01      ---
W5N4F7_BCL2-01          ---
K7F5Y3_BCL2-02          ---
A0A3Q2HRY3_BCL2-02      ---
H0YUX3_BCL2-01          ---
K7F5Y3_BCL2-01          ---
F1LNV0_BCL2-01          ---
P49950_BCL2-01          ---
G1TW27_BCL2-01          ---
A0A2K5EB04_BCL2-01      ---
A0A2R8MY14_BCL2-01      ---
H2NWH5_BCL2-01          ---
A0A096MPU7_BCL2-01      ---
A0A2K5PP81_BCL2-01      ---
H0WKI0_BCL2-01          ---
A0A2K5UDI5_BCL2-01      ---
P10417_BCL2-01          ---
Q7TSN8_BCL2-01          ---
A0A3Q2HRY3_BCL2-01      ---
E2QWA1_BCL2-02          ---
A0A2K6G3I7_BCL2-01      ---
Q6R755_BCL2-01          ---
Q9JJV8_BCL2-01          ---
Q923R6_BCL2-01          ---
H0W1T3_BCL2-01          ---
G1LIC9_BCL2-02          ---
I3MVK9_BCL2-01          ---
                           

© 1998-2020Legal notice