Dataset for protein Bcl-2 of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

101 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1MZW1_BCL2-01          --------------------------------------------------
A0A3P8YNB4_BCL2-01      ------------------------MADDDNRFIVEKYICHKLLKRGYAWD
A0A3P8WUE9_BCL2-01      ---------------MYLVPNSAGMASECNRYIVEKYICHKLAKRGYVWE
A0A3B4A3G8_BCL2-01      ------------------------MANDCNRNIVEKYICHKLSKRGFAWG
A0A3Q3G1D7_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKRGYEWG
A0A3Q2XQX2_BCL2-02      ------------------------MANERNRTIVENYICHKLSKRGYAWG
A0A3Q2XQX2_BCL2-01      ------------------------MANERNRTIVENYICHKLSKRGYAWG
A0A3Q3B0R2_BCL2-01      --------------------------MEVNRFIVENYICHKLSKRGYAWG
A0A3Q2PN77_BCL2-01      ------------------------MANDCNRDIVENYIFHKLSKRGYAWR
A0A3P9J8Y9_BCL2-01      ------------------------MANVSNRSIVEKYICHKLSKRGYVCG
A0A3Q0S5Z7_BCL2-01      ------------------------MANEYNRNIVEKYICHKLSKRGYAWG
A0A3P8QVM8_BCL2-01      ------------------------MENEYNRNIVEKYICHKLSKRGFVWG
A0A3P9DIG5_BCL2-01      ------------------------MENEYNRNIVEKYICHKLSKRGFVWG
A0A3Q2UYW8_BCL2-01      ------------------------MANEYNRNIVEKYICHKLSKRGFVWG
A0A3B4G3K4_BCL2-01      ------------------------MANEYNRNIVEKYICHKLSKRGFVWG
A0A2U9BJ09_BCL2-01      ------------------------MASECNRNIVEKYICHKLSKRGYVWG
A0A3Q1I5N1_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKRGYAWG
A0A3Q3K1K1_BCL2-01      ------------------------MANECNRNVVEKYICHKLSKRGYVWG
A0A3Q3MEY1_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKRGYVWG
A0A1X9JZA1_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKQGYEWG
A0A4D6FTA2_BCL2-01      ------------------------MANERNRNIVEKYICHKLSKQGYVWG
A0A3Q1FLK7_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKRGYVWG
A0A3Q1B8C3_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKRGYVWG
A0A3P8S9L3_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKRGYVWG
A0A3B5BBQ0_BCL2-01      ------------------------MANECNRNIVEKYICHKLSKRGYAWG
A0A3B4TX71_BCL2-01      ------------------------MASEYNRNIVEKYICHKLSKQGYVWG
A0A3B4YAG2_BCL2-01      ------------------------MASEYNRNIVEKYICHKLSKRGYVWG
G1TW27_BCL2-02          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A3B3TCS4_BCL2-01      ---------------------MANDVPYDSRNIVEIYIYHKLLKTGYVWE
A0A0U3DHY6_BCL2-01      ---------------------MANENPYDSRFIVEKYIHNKLLKKGFVWE
A0A3P9AAB2_BCL2-01      ---------------------MANENPYDSRVIVENYIYDKLLKNGFVWE
X4ZGI8_BCL2-01          ---------------------MANEIRYDNRNIVEKYLNHKLSKKGYEWK
B9ZYL7_BCL2-01          -------------------MAHPRRGGYDHRDIVVKYIHYKLSQKGYAWE
F6YNL8_BCL2-01          ------------------MMAHPGRRGYDNREIVMKYIHYKLSQRGYEWD
A0A218UQA0_BCL2-01      -------------------MAHPGRRGYDNREIVLKYIHYKLSQRGYDWA
Q00709_BCL2-01          -------------------MAHPGRRGYDNREIVLKYIHYKLSQRGYDWA
A0A493T1X3_BCL2-01      -------------------MAHPGRRGYDNREIVLKYIHYKLSQRGYDWA
U3KEW4_BCL2-01          -------------------MAHPGRRGYDNREIVLKYIHYKLSQRGYDWA
G3WZW9_BCL2-01          -------------------MAHPGRRGYDNREIVMKYIHYKLSQRGYEWD
M3YYK3_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRG----
M3X1R9_BCL2-02          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K6R2I5_BCL2-02      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2R9APW6_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
G3SLZ1_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWE
Q75SV7_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
M3X1R9_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
Q8I008_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYELPQRGYEWD
A0A076FU27_BCL2-01      -------------------MAHAGGTGYDNREIVMKYIHYKLSQRGYEWD
A0A4P8GLJ2_BCL2-01      -------------------MAHAGGTGYDNREIVMKYIHYKLSQRGYEWD
F6R2C4_BCL2-01          -------------------MAHAGGTGYDNREIVMKYIHYKLSQRGYEWD
O02718_BCL2-01          -------------------MAHAGGTGYDNREIVMKYIHYKLSQRGYEWD
A0A076FZV9_BCL2-01      -------------------MAHAGGTGYDNREIVMKYIHYKLSQRGYEWD
A0A452EV13_BCL2-01      -------------------MAHAGGTGYDNREIVMKYIHYKLSQRGYEWD
A0A250YD83_BCL2-01      -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
A9QXG9_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K5NZS5_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A0D9S017_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K6CIX3_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K5XRD4_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K6KHG1_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K6R2I5_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K5HK49_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
G3QES9_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
H2QEM8_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2I3GZF9_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K6UEL3_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
E2QWA1_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-01          --------------------------------------------------
A0A452R110_BCL2-01      -------------------------------------------------M
A0A452R110_BCL2-02      ---MPETRAPRPRGPPPRRASSPPSLGSPPRPPGPRRLPPPAAPAAAA--
G3WZW9_BCL2-02          ---PFGCSPWCSLLSPLGIMAHPGRRGYDNREIVMKYIHYKLSQRGYD--
G3SLZ1_BCL2-02          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWE
A0A452T603_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYD--
Q564A4_BCL2-01          ---------------------MANEISYDNRNIVEKYLKHKLSKRGYVWK
H9GPE7_BCL2-01          -------------------MAHPGIRGYDNREIVLRYIHYKLSQKGYDWV
A0A452I9V7_BCL2-01      MYLTACVCTLHWREKHSTSARAWSQRGYDNREIVLKYIHYKLSQRGYDWA
W5N4F7_BCL2-01          --------------------MANNEAPYDTRNIVTKYIHHKLLKKGYVWE
K7F5Y3_BCL2-02          -------------------MAHPGRRGYDNREIVLKYIHYKLSQRGYDWA
A0A3Q2HRY3_BCL2-02      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
K7F5Y3_BCL2-01          -------------------MAHPGRRGYDNREIVLKYIHYKLSQRGYDWA
F1LNV0_BCL2-01          -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
P49950_BCL2-01          -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
G1TW27_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K5EB04_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2R8MY14_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
H2NWH5_BCL2-01          -------------------MAHAGTTGYDNREIVDEXIHYKLSQRGYEWD
A0A096MPU7_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K5PP81_BCL2-01      -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
H0WKI0_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K5UDI5_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
P10417_BCL2-01          -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
Q7TSN8_BCL2-01          -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A3Q2HRY3_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
E2QWA1_BCL2-02          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
A0A2K6G3I7_BCL2-01      -------------------MAHAGRTGYDNREIVMKYIHYKLAQRGYEWD
Q6R755_BCL2-01          -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
Q9JJV8_BCL2-01          -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
Q923R6_BCL2-01          -------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD
H0W1T3_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
G1LIC9_BCL2-02          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
I3MVK9_BCL2-01          -------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD
                                                                          

G1MZW1_BCL2-01          --------------------------------------------------
A0A3P8YNB4_BCL2-01      F--EDAE--EEDGANN-------GSMISPPPGLVRRIHGASK--A-----
A0A3P8WUE9_BCL2-01      H--DEDR--DGDAANN-------GSIVSRPPTLVHRCRGAST-GP-----
A0A3B4A3G8_BCL2-01      FHEDAED--EGDVANN-------GSIVASSPVLVNRRCRAER--------
A0A3Q3G1D7_BCL2-01      F--EDEQ--DEDAANN-------GSLVAPPPTLVRRCREASS-GP-----
A0A3Q2XQX2_BCL2-02      F--GAGE--ED---------------------------------------
A0A3Q2XQX2_BCL2-01      F--GAED--DAAAANN-------GLLVAPSPTLVLRCREASS-GP-----
A0A3Q3B0R2_BCL2-01      S--DRPRRVRDDAANN-------GSVASQSPTLVRRCRGARG-APGGAGT
A0A3Q2PN77_BCL2-01      F--DGVR--DDDAAAN-------GGLGDRSPTLVRRCRDAAAPGQ-----
A0A3P9J8Y9_BCL2-01      L--NGGQ--RENAANN-------GSVGDHSPTPVRRRCDAGT-GP-----
A0A3Q0S5Z7_BCL2-01      F--DGVQ--DEDAANN-------GSINDPPPTLVRRCREPSN-GP-----
A0A3P8QVM8_BCL2-01      F--RVVQ--EEDAANN-------GSITDPPPTLVHRCREAST-GP-----
A0A3P9DIG5_BCL2-01      F--RVVQ--EEDAANN-------GSITDPPPTLVHRCREAST-GP-----
A0A3Q2UYW8_BCL2-01      F--RVVQ--EEDAANN-------GSITDPPPTLVHRCREAST-GP-----
A0A3B4G3K4_BCL2-01      F--RVVQ--EEDAANN-------GSITDPPPTLVHRCREAST-GP-----
A0A2U9BJ09_BCL2-01      F--DDVR--DEDAADN-------GSIVAPPPTLVRRCHGAST-GP-----
A0A3Q1I5N1_BCL2-01      F--HDAQ--DEDAANN-------GSAVPPPPTLVRRCREAST-GP-----
A0A3Q3K1K1_BCL2-01      F--HDVQ--DEDAANN-------GSIVAPPPTLVRRCREAST-GP-----
A0A3Q3MEY1_BCL2-01      F--HNVQ--DEDAANN-------GSVVAPPPTVVRRCRDAST-GP-----
A0A1X9JZA1_BCL2-01      F--DAVR--NADAGNN-------GSIVAPPPSLVRRCRGAST-GP-----
A0A4D6FTA2_BCL2-01      F--DDVR--DEDAANN-------GSIVAPPPTLVRRCREAST-GP-----
A0A3Q1FLK7_BCL2-01      F--DDVR--DEDAANN-------GSVVDPPPTLVRRCHEAST-GP-----
A0A3Q1B8C3_BCL2-01      F--DDVR--DEDAANN-------GSVVDPPPTLVRRCHEAST-GP-----
A0A3P8S9L3_BCL2-01      F--DDVR--DEDAANN-------GSVVDPPPTLVRRCHEAST-GP-----
A0A3B5BBQ0_BCL2-01      F--DDVR--DEDAANN-------GSVVDPPPTLVRRCHEAST-GP-----
A0A3B4TX71_BCL2-01      F--DDVR--DEDAANN-------GSIVAPPPTLVRRCREANT-GP-----
A0A3B4YAG2_BCL2-01      F--DDVR--DEDAANN-------GSIVAPPPTLVRRCREANT-GP-----
G1TW27_BCL2-02          AG-------DA------------GAASAPGVFSSQP----APAAPRD---
A0A3B3TCS4_BCL2-01      FQ---------------------AAGDTDSPNNGSVDSPPGSQV------
A0A0U3DHY6_BCL2-01      FQ---------------------AENDSPNNLFGDPSTPNTPEV------
A0A3P9AAB2_BCL2-01      FQ---------------------TENQSRNNVFEDPSPPNSPEL------
X4ZGI8_BCL2-01          FQ---------------------SSGEDDDTINTGVEDSSPSSDRRL---
B9ZYL7_BCL2-01          EGRQQVSAEHPQASAAISNYSDDGEMPAASADSRGPPQSSLASAASSDEE
F6YNL8_BCL2-01          AG-------DLRAPASPSLPPVVASAPAVGIFSTQPRNTPLPAAA-----
A0A218UQA0_BCL2-01      AG-------E-------------DRVSLPPDHSASAAAAIAAAG--TSDH
Q00709_BCL2-01          AG-------E-------------DRPPVPPAPAPAAAPAAVAAAGASSHH
A0A493T1X3_BCL2-01      AG-------E-------------DRAPAPTALAPAAAAVAAAGTPSRHRP
U3KEW4_BCL2-01          AG-------E-------------HRAPLPPGLSAPAAAAVAAAAGTSSDH
G3WZW9_BCL2-01          AG-------NLRTPASPSLPPVVASAPAVGIFSNQPRHTPLPAAPQDLAT
M3YYK3_BCL2-01          -------------------------RPVMKLVYLPTAPPPPPLSRHR---
M3X1R9_BCL2-02          AG-------DAGAAPP-------GAAPAPGIFSSQPGRTPAP--------
A0A2K6R2I5_BCL2-02      AG-------DVGAATP-------GAAPAPGIFSSQPGHTPHPAASRD---
A0A2R9APW6_BCL2-01      AG-------DVGAAP-----------------------------------
G3SLZ1_BCL2-01          AG-------EASAAPP-------GAAPAPGVLSSPPAAPRGPD-------
Q75SV7_BCL2-01          AG-------EAGAAPP-------GAAPAPGIFSSQPGRAPAP--------
M3X1R9_BCL2-01          AG-------DAGAAPP-------GAAPAPGIFSSQPGRTPAP--------
Q8I008_BCL2-01          AG-------DAGAAPP-------GAAPAPGIFSSQPGRTPAP--------
A0A076FU27_BCL2-01      AR-------AAGAAPP-------GAAPAPGILSSQPGRTPAP--------
A0A4P8GLJ2_BCL2-01      AG-------DAGAAPP-------GAAPAPGILSSQPGRTPAP--------
F6R2C4_BCL2-01          AG-------DAGAAPP-------GAAPAPGILSSQPGRTPAP--------
O02718_BCL2-01          AG-------DAGAAPP-------GAAPAPGILSSQPGRTPAP--------
A0A076FZV9_BCL2-01      AG-------AAGAAPP-------GAAPAPGILSSQPGRTPAP--------
A0A452EV13_BCL2-01      AG-------AAGAAPP-------GAAPAPGILSSQPGRAPAP--------
A0A250YD83_BCL2-01      AG-------DVGAAPP-------EATPAPGIFSFQPGSNPLPAAPRD---
A9QXG9_BCL2-01          AG-------DVGAAPP-------GAAPAPGIFSSQPGHTPHPAASRD---
A0A2K5NZS5_BCL2-01      AG-------DVGAATP-------GVAPAPGIFSSQPGHTPHPAASRD---
A0A0D9S017_BCL2-01      AG-------DVGAATP-------GAAPAPGIFSSQPGHTPHPAASRD---
A0A2K6CIX3_BCL2-01      AG-------DVGAATP-------GAAPAPGIFSSQPGHTPHPAASRD---
A0A2K5XRD4_BCL2-01      AG-------DVGAATP-------GVAPAPGIFSSQPGHTPHPAASRD---
A0A2K6KHG1_BCL2-01      AG-------DVGAATP-------GAAPAPGIFSSQPGHTPHPAASRD---
A0A2K6R2I5_BCL2-01      AG-------DVGAATP-------GAAPAPGIFSSQPGHTPHPAASRD---
A0A2K5HK49_BCL2-01      AG-------DVGAATP-------GAAPAPGIFSSQPGHTPHPAASRD---
G3QES9_BCL2-01          AG-------DVGAVPP-------GAAPAPGIFSSQPGHTPHPAASRD---
H2QEM8_BCL2-01          AG-------DVGAAPP-------GAAPAPGIFSSQPGHTPHPAASRD---
A0A2I3GZF9_BCL2-01      AG-------DVGAAPP-------GAAPAPGIFSSQPGHTPHPAASRD---
A0A2K6UEL3_BCL2-01      AG-------DVGAAPP-------GAAPAPGIFSSQPGHTPGPAAPRD---
E2QWA1_BCL2-01          ------------PFQF-------GGCPVSFSG-PELASPPPPPGP-----
G1LIC9_BCL2-01          ---------------------------------PHPAASPRPFVRRW---
A0A452R110_BCL2-01      PE-------TRAPRPR-------GPPPRRASSPPSLGSPPRPPGPRR---
A0A452R110_BCL2-02      ----------------------------A---------------------
G3WZW9_BCL2-02          ----------------------------V---------------------
G3SLZ1_BCL2-02          AG-------EADTRTS-------PLQADP---------------------
A0A452T603_BCL2-01      --------------------------------------------------
Q564A4_BCL2-01          CQ---------------------SSAEEDDTFNKAVEESSPNSDRRL---
H9GPE7_BCL2-01          AS-------GDRGK---------SASLSPELLNSDPVSTNAPREEPD---
A0A452I9V7_BCL2-01      AN-------ENRGPVS-------PNLSPPTVTGTSSDHAGLMSLPPE---
W5N4F7_BCL2-01          SR-------VSGETDPPNNGLVGPSASGPGLQARRLQAAGAERGAVP---
K7F5Y3_BCL2-02          AN-------E-NRGPV-------SSSLSPPAAGTPSDHAGLVSLPPE---
A0A3Q2HRY3_BCL2-02      AG-------DAGAAPL-------GATPVPGIFSSQPGRTPAP--------
K7F5Y3_BCL2-01          AN-------E-NRGPV-------SSSLSPPAAGTPSDHAGLVSLPPE---
F1LNV0_BCL2-01          TG-------DEDSAPL-------RAAPTPGIFSFQPESNRTPAVHRD---
P49950_BCL2-01          TG-------DEDSAPL-------RAAPTPGIFSFQPESNRTPAVHRD---
G1TW27_BCL2-01          AG-------DA------------GAASAPGVFSSQP----APAAPRD---
A0A2K5EB04_BCL2-01      AG-------DVGAAPP-------GAAPAPGIFSSQPGHTPGPAAPRD---
A0A2R8MY14_BCL2-01      AG-------DVGAAPP-------GAAPAEGIFSSQPGHTPGPAAPRD---
H2NWH5_BCL2-01          AG-------DVGAAPP-------GAATAPGIFSSQPGHTPHPAASRD---
A0A096MPU7_BCL2-01      AG-------D-GAATP-------GAAPAPGIFSSQPGHTPHPAASRD---
A0A2K5PP81_BCL2-01      AG-------DVGAAPP-------GAAPAPGIFSSQPGHTPGPAAPRD---
H0WKI0_BCL2-01          AG-------DVGVAPP-------GAATAPGVFSSQPGRTPTPAAPRD---
A0A2K5UDI5_BCL2-01      AG-------DVGAATP-------GAAPAPGIFSSQPGHTPHPAASRD---
P10417_BCL2-01          AG-------DADAAPL-------GAAPTPGIFSFQPESNPMPAVHRD---
Q7TSN8_BCL2-01          AG-------DADAAPL-------GAAPTPGIFSFQPESNPMPAVHRD---
A0A3Q2HRY3_BCL2-01      AG-------DAGAAPL-------GATPVPGIFSSQPGRTPAPA--RT---
E2QWA1_BCL2-02          AG-------EAGAAPP-------GAAPAPGISASQX-XXXXXXXXXX---
A0A2K6G3I7_BCL2-01      AG-------DAGAAPP-------GAAPTPGIFSSQPGRNPPPAAPRD---
Q6R755_BCL2-01          VG-------DVDAAPL-------GAAPTPGIFSFQPESNPTPAVHRD---
Q9JJV8_BCL2-01          VG-------DVDAAPL-------GAAPTPGIFSFQPESNPTPAVHRD---
Q923R6_BCL2-01          VG-------DVDAAPL-------GAAPTPGIFSFQPESNPTPAVHRD---
H0W1T3_BCL2-01          AG-------DGSALGR-------NSPLGV---------------PRD---
G1LIC9_BCL2-02          AG-------DAAPAA-----------------------------------
I3MVK9_BCL2-01          AG-------DVGAASP-------GAAPGPGIFSSQPG-------SHT---
                                                                          

G1MZW1_BCL2-01          --------------------------------------------------
A0A3P8YNB4_BCL2-01      -----GQGSVPHIS------------K-WLS-------------------
A0A3P8WUE9_BCL2-01      -----GNDGIPNLC------------K-RPP-------------------
A0A3B4A3G8_BCL2-01      --------------------------L-CSA-------------------
A0A3Q3G1D7_BCL2-01      -----DRESIPHLC------------K-RPP-------------------
A0A3Q2XQX2_BCL2-02      --------------------------D-RSH-------------------
A0A3Q2XQX2_BCL2-01      -----ERDCAP---------------K-RSH-------------------
A0A3Q3B0R2_BCL2-01      APPDAESDPDPVLC------------G-RIS-------------------
A0A3Q2PN77_BCL2-01      -----DSDGDPRRV------------RGRLS-------------------
A0A3P9J8Y9_BCL2-01      -----DEESSPRLI------------R-ALS-------------------
A0A3Q0S5Z7_BCL2-01      -----DGESNTHLC------------R-RLP-------------------
A0A3P8QVM8_BCL2-01      -----DGESNTHLC------------R-RLP-------------------
A0A3P9DIG5_BCL2-01      -----DGESNTHLC------------R-RLP-------------------
A0A3Q2UYW8_BCL2-01      -----DGESNTHLC------------R-RLP-------------------
A0A3B4G3K4_BCL2-01      -----DGESNTHLC------------R-RLP-------------------
A0A2U9BJ09_BCL2-01      -----DDESHPDLC------------R-RPP-------------------
A0A3Q1I5N1_BCL2-01      -----DSDSIPQHC------------R-RLP-------------------
A0A3Q3K1K1_BCL2-01      -----DSESTPHRC------------K-RPP-------------------
A0A3Q3MEY1_BCL2-01      -----DSESIPQLC------------R-GLP-------------------
A0A1X9JZA1_BCL2-01      -----DSESIPHLC------------T-RLP-------------------
A0A4D6FTA2_BCL2-01      -----DTESIPHLC------------K-RLP-------------------
A0A3Q1FLK7_BCL2-01      -----DNESDPHLC------------R-RLP-------------------
A0A3Q1B8C3_BCL2-01      -----DNESDPHLC------------R-RLP-------------------
A0A3P8S9L3_BCL2-01      -----DNESDPHLC------------R-RLP-------------------
A0A3B5BBQ0_BCL2-01      -----DNESDPHLC------------R-RLP-------------------
A0A3B4TX71_BCL2-01      -----DNDSSPNLC------------R-RLS-------------------
A0A3B4YAG2_BCL2-01      -----DNDSSPNLC------------R-RLS-------------------
G1TW27_BCL2-02          ---PAARTSPPPPPA-----------A-AGP-------------------
A0A3B3TCS4_BCL2-01      ---LARRSQAAAAGGEDASPVRSRTPR-FDP-------------------
A0A0U3DHY6_BCL2-01      ---FARRSQPTAAVEDTDSPFQNRSPQ-PDP-------------------
A0A3P9AAB2_BCL2-01      ---FARRLQPPAAGEDNDPQFANRIPQ-PDP-------------------
X4ZGI8_BCL2-01          -----------QAPSAGGGNNSECLIA-NRV-------------------
B9ZYL7_BCL2-01          TPSNTPITFVGNAPAVPRRSAS----A-VSPLAELNVEPRDLNVNPDASR
F6YNL8_BCL2-01          --------------------------A-AGP-------------------
A0A218UQA0_BCL2-01      TGLVSPHPEPPGSATASHT-------P-PAE-------------------
Q00709_BCL2-01          ------RPEPPGSAAASEV-------P-PAE-------------------
A0A493T1X3_BCL2-01      AGLLSPHPEPPGSAAASEA-------P-PGE-------------------
U3KEW4_BCL2-01          TGPVSPHPEPPGSAAASPA-------P-PAE-------------------
G3WZW9_BCL2-01          STTAAARNSPLPPPPAVAAATV----A-AGP-------------------
M3YYK3_BCL2-01          ---RPQLTSPATALAAAA--------A-AGP-------------------
M3X1R9_BCL2-02          -----ARTSPPPPPVAPAAAAAAA--A-AGP-------------------
A0A2K6R2I5_BCL2-02      ---PVARTSPLPTPAAPAA-------A-AGP-------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
G3SLZ1_BCL2-01          -----TRTSPLQADP-----------A-AQP-------------------
Q75SV7_BCL2-01          -----ARTSPPPPPAAPAAAAAAAADA-AGP-------------------
M3X1R9_BCL2-01          -----ARTSPPPPPVAPAAAAAAA--A-AGP-------------------
Q8I008_BCL2-01          -----ARTSPPPPPVAP--AAAAA--A-AGP-------------------
A0A076FU27_BCL2-01      -----SRTSPPPPPAA----------A-AGP-------------------
A0A4P8GLJ2_BCL2-01      -----SRTSPPPPPAA----------A-AGP-------------------
F6R2C4_BCL2-01          -----SRTSPPPPPAA----------A-AGP-------------------
O02718_BCL2-01          -----SRTSPPPPPAA----------A-AGP-------------------
A0A076FZV9_BCL2-01      -----SRTSPPPPPAA----------A-AGP-------------------
A0A452EV13_BCL2-01      -----SRTSPPPPPAA----------A-AGP-------------------
A0A250YD83_BCL2-01      ---RAARTTSLPPPVAPAA-------R-AGP-------------------
A9QXG9_BCL2-01          ---PVARTSPLQTPAAPGA-------A-AGP-------------------
A0A2K5NZS5_BCL2-01      ---PVARTSPLPTPAAPAA-------A-AGP-------------------
A0A0D9S017_BCL2-01      ---PVARTSPLPTPAAPAA-------A-AGP-------------------
A0A2K6CIX3_BCL2-01      ---PVARTSPLPTPAAPAA-------A-AGP-------------------
A0A2K5XRD4_BCL2-01      ---PVARTSPLPTPAAPAA-------A-AGP-------------------
A0A2K6KHG1_BCL2-01      ---PVARTSPLPTPAAPAA-------A-AGP-------------------
A0A2K6R2I5_BCL2-01      ---PVARTSPLPTPAAPAA-------A-AGP-------------------
A0A2K5HK49_BCL2-01      ---PVARTSPLPTPAAPAA-------A-AGP-------------------
G3QES9_BCL2-01          ---RVARTSPLQTPAAPGA-------A-AGP-------------------
H2QEM8_BCL2-01          ---PVARTSPLQTPAAPGA-------A-AGP-------------------
A0A2I3GZF9_BCL2-01      ---PVARTSPLPTPAAPGA-------A-AGP-------------------
A0A2K6UEL3_BCL2-01      ---PVARTXXXXXXXXXXX-------X-XXX-------------------
E2QWA1_BCL2-01          ---------PAAAAAAAFP-------P-RAP-------------------
G1LIC9_BCL2-01          ---QVAP--PSAAAAAA------------GP-------------------
A0A452R110_BCL2-01      ---LPPPAAPAAAAAAA------------GP-------------------
A0A452R110_BCL2-02      --------------------------A-AGP-------------------
G3WZW9_BCL2-02          --------------------------A-AGP-------------------
G3SLZ1_BCL2-02          --------------------------A-AQP-------------------
A0A452T603_BCL2-01      --------------------------------------------------
Q564A4_BCL2-01          ---QAPSAGGGNNSECLIARVT----R-SDP-------------------
H9GPE7_BCL2-01          --------------------------------------------------
A0A452I9V7_BCL2-01      ---PPGSAAASNVP--------------LGD-------------------
W5N4F7_BCL2-01          ---VPRRTPPPDPH------------------------------------
K7F5Y3_BCL2-02          ---PPGSAAASNVP--------------LGD-------------------
A0A3Q2HRY3_BCL2-02      -----ARTSPLLPP---AAPAG----A-AGP-------------------
K7F5Y3_BCL2-01          ---PPGSAAASNVP--------------LGD-------------------
F1LNV0_BCL2-01          ---TAARTSPLRPL------VA----T-AGP-------------------
P49950_BCL2-01          ---TAARTSPLRPL------VA----N-AGP-------------------
G1TW27_BCL2-01          ---PAARTSPPPPP-------A----A-AGP-------------------
A0A2K5EB04_BCL2-01      ---PVSRTSPPPPP--AAPAAA----A-TGP-------------------
A0A2R8MY14_BCL2-01      ---PVARTSPPPPP--AAPAAA----A-TGP-------------------
H2NWH5_BCL2-01          ---P-ARTSPLPTP---AAPGA----A-VGP-------------------
A0A096MPU7_BCL2-01      ---PVARTSPLPTP---AAPAA----A-AGP-------------------
A0A2K5PP81_BCL2-01      ---PVARTSPPSPP--AAPAAA----A-TGP-------------------
H0WKI0_BCL2-01          ---PAARTSPPAAP----AAAA----A-AEP-------------------
A0A2K5UDI5_BCL2-01      ---PVARTSPLPTPAAPAAAAA----A-AGP-------------------
P10417_BCL2-01          ---MAARTSPLRPL------VA----T-AGP-------------------
Q7TSN8_BCL2-01          ---MAARTSPLRPL------VA----T-AGP-------------------
A0A3Q2HRY3_BCL2-01      ---SPLLPPA--AP------AG----A-AGP-------------------
E2QWA1_BCL2-02          ---XXXXXXX--XX------XX----X-XXX-------------------
A0A2K6G3I7_BCL2-01      ---PAARTSP--PP------AA----A-AGP-------------------
Q6R755_BCL2-01          ---MAARTSPLRPI------VA----T-TGP-------------------
Q9JJV8_BCL2-01          ---MAARTSPLRPI------VA----T-TGP-------------------
Q923R6_BCL2-01          ---MAARTSPLRPI------VA----T-TGP-------------------
H0W1T3_BCL2-01          ---PAARTSPPPPL---AGLAV----A-QGP-------------------
G1LIC9_BCL2-02          --------------------AA----A-AGP-------------------
I3MVK9_BCL2-01          ---PAARTSPPPPP---AAPAA----A-AGP-------------------
                                                                          

G1MZW1_BCL2-01          --------------------------------------------------
A0A3P8YNB4_BCL2-01      ---------------QPDP-HAAIHRVLREAGDELERLYQPDFLEMSHQL
A0A3P8WUE9_BCL2-01      ---------------APEA-HAAIHRVLREAGDELERLYQPDFSEMSRQL
A0A3B4A3G8_BCL2-01      ---------------PSDP-HAAIHRVLREAGDELERLYQPDFTEMSRQL
A0A3Q3G1D7_BCL2-01      ---------------QSDPAYADIHRVLREAGDELERLYQPDFTEMSRQL
A0A3Q2XQX2_BCL2-02      ---------------GSDP-LADIHRVLREAGDELERLYQPDFTEMSRQL
A0A3Q2XQX2_BCL2-01      ---------------GSDP-LADIHRVLREAGDELERLYQPDFTEMSRQL
A0A3Q3B0R2_BCL2-01      ---------------PHEP-LAHIHRVLREAGDELERLYQPDFVEMSRQL
A0A3Q2PN77_BCL2-01      ---------------QSDP-HADIHRVLREAGDELERLYQLDFAEMSQQL
A0A3P9J8Y9_BCL2-01      ---------------RADP-LADIHRVLREAGDELERLYQRDFTEMSRQL
A0A3Q0S5Z7_BCL2-01      ---------------QSDP-HADIHRVLREAGDELERLYQPDFTEMSRQL
A0A3P8QVM8_BCL2-01      ---------------QSDP-HAGIHRVLREAGDELERLYQPDFTEMSRQL
A0A3P9DIG5_BCL2-01      ---------------QSDP-HAGIHRVLREAGDELERLYQPDFTEMSRQL
A0A3Q2UYW8_BCL2-01      ---------------QSDP-HAGIHRVLREAGDELERLYQPDFTEMSRQL
A0A3B4G3K4_BCL2-01      ---------------QSDP-HAGIHRVLREAGDELERLYQPDFTEMSRQL
A0A2U9BJ09_BCL2-01      ---------------QSEP-RAAVHRVLREAGDELERLYQPDFTEMSRQL
A0A3Q1I5N1_BCL2-01      ---------------PSDP-HAALHRVLREAGDELERLYQPDFTEMSRQL
A0A3Q3K1K1_BCL2-01      ---------------QSDM-HAAIHRVLREAGDELERLYQPDFTEMSRQL
A0A3Q3MEY1_BCL2-01      ---------------QSDP-QAAIHRVLREAGDELERLYQPDFTEMSRQL
A0A1X9JZA1_BCL2-01      ---------------QSDP-HAAIHRVLREAGDELERLYQPDFTEMSRQL
A0A4D6FTA2_BCL2-01      ---------------QSDP-HAAIHRVLREAGDELERLYQPDFTEMSRQL
A0A3Q1FLK7_BCL2-01      ---------------QSDP-HAAIHRVLREAGDELERLYQPDFTEMSRQL
A0A3Q1B8C3_BCL2-01      ---------------QSDP-HAAIHRVLREAGDELERLYQPDFTEMSRQL
A0A3P8S9L3_BCL2-01      ---------------QSDP-HAAIHRVLREAGDELERLYQPDFTEMSRQL
A0A3B5BBQ0_BCL2-01      ---------------QSDP-HAAIHRVLREAGDELERLYQPDFTEMSRQL
A0A3B4TX71_BCL2-01      ---------------QSDP-HAEIHRVLREAGDELERLYQPDFTEMSRQL
A0A3B4YAG2_BCL2-01      ---------------QSDP-HAEIHRVLREAGDELERLYQPDFTEMSRQL
G1TW27_BCL2-02          ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A3B3TCS4_BCL2-01      --------------------HARLHRVLREAGDEIERMFQRDFSEMHEEL
A0A0U3DHY6_BCL2-01      --------------------HVRLHRVLREAGDEIERMYLRDFAEMSGQL
A0A3P9AAB2_BCL2-01      --------------------HARLHRVLRDAGNEIERMYQRDFAEMSGQL
X4ZGI8_BCL2-01          ---------------TRSDPYSRIYRSLREAGDQIERMYQREFEEMSHQM
B9ZYL7_BCL2-01          AADGDNNDADGGDEAVMQPVPSAVLQTLSRAGDEFSRLYQQDFRQISGLL
F6YNL8_BCL2-01          ---------------TVSPVPPVVHLTLRQAGDDFSRRYRRDFDEMSGQL
A0A218UQA0_BCL2-01      ---------------GLRPAPQVVHLVLRQAGDEFSRRYQRDFSQMSGQL
Q00709_BCL2-01          ---------------GLRPAPPGVHLALRQAGDEFSRRYQRDFAQMSGQL
A0A493T1X3_BCL2-01      ---------------GLRPAPPVVHLALRQAGDEFSRRYQRDFAQMSGQL
U3KEW4_BCL2-01          ---------------GLRPAPQVVHLVLRQAGDEFSRRYQRDFAQMSGQL
G3WZW9_BCL2-01          ---------------AVSPVPPVVHLTLRQAGDDFSRRYRRDFDEMSGQL
M3YYK3_BCL2-01          ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
M3X1R9_BCL2-02          ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A2K6R2I5_BCL2-02      ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A2R9APW6_BCL2-01      ----------------LSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
G3SLZ1_BCL2-01          ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
Q75SV7_BCL2-01          ---------------APSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
M3X1R9_BCL2-01          ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
Q8I008_BCL2-01          ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A076FU27_BCL2-01      ---------------APSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A4P8GLJ2_BCL2-01      ---------------APSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
F6R2C4_BCL2-01          ---------------APSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
O02718_BCL2-01          ---------------APSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A076FZV9_BCL2-01      ---------------APSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A452EV13_BCL2-01      ---------------APSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A250YD83_BCL2-01      ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A9QXG9_BCL2-01          ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A2K5NZS5_BCL2-01      ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A0D9S017_BCL2-01      ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A2K6CIX3_BCL2-01      ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A2K5XRD4_BCL2-01      ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A2K6KHG1_BCL2-01      ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A2K6R2I5_BCL2-01      ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A2K5HK49_BCL2-01      ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
G3QES9_BCL2-01          ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
H2QEM8_BCL2-01          ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A2I3GZF9_BCL2-01      ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A2K6UEL3_BCL2-01      ---------------XXSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
E2QWA1_BCL2-01          ---------------XXSPVPPVVHLTLRQAGDDFSRRYRR-FAEMSSQL
G1LIC9_BCL2-01          ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A452R110_BCL2-01      ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A452R110_BCL2-02      ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
G3WZW9_BCL2-02          ---------------AVSPVPPVVHLTLRQAGDDFSRRYRRDFDEMSGQL
G3SLZ1_BCL2-02          ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A452T603_BCL2-01      ------------------PVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
Q564A4_BCL2-01          ---------------HLR-----LYRVLRDAGDEIERIYQREFEEMSQQM
H9GPE7_BCL2-01          ------------------PVPQVVHTTLRQAGDEFSRRYRRDFAQMSGQL
A0A452I9V7_BCL2-01      ---------------GLRPAPQAVLLALCQAGDEFSRRYHRDFAQMSGQL
W5N4F7_BCL2-01          ---------------------AALHKVLREAGDEIERMYHRDFAEMSDQL
K7F5Y3_BCL2-02          ---------------GLRSAPQAVHLTLCQAGDEFSRRYHRDFAQMSGQL
A0A3Q2HRY3_BCL2-02      ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
K7F5Y3_BCL2-01          ---------------GLRSAPQAVHLTLCQAGDEFSRRYHRDFAQMSGQL
F1LNV0_BCL2-01          ---------------ALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQL
P49950_BCL2-01          ---------------ALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQL
G1TW27_BCL2-01          ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A2K5EB04_BCL2-01      ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A2R8MY14_BCL2-01      ---------------TLSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
H2NWH5_BCL2-01          ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A096MPU7_BCL2-01      ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A2K5PP81_BCL2-01      ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
H0WKI0_BCL2-01          ---------------LLSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
A0A2K5UDI5_BCL2-01      ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
P10417_BCL2-01          ---------------ALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQL
Q7TSN8_BCL2-01          ---------------ALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQL
A0A3Q2HRY3_BCL2-01      ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
E2QWA1_BCL2-02          ---------------XXSPVPPVVHLTLRQAGDDFSRRYRR-FAEMSSQL
A0A2K6G3I7_BCL2-01      ---------------APSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
Q6R755_BCL2-01          ---------------TLSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQL
Q9JJV8_BCL2-01          ---------------TLSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQL
Q923R6_BCL2-01          ---------------TLSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQL
H0W1T3_BCL2-01          ---------------ALSPVPPVVHLTLRQAGDDFSRRYRQDFAEMSSQL
G1LIC9_BCL2-02          ---------------ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
I3MVK9_BCL2-01          ---------------VLSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL
                                                                          

G1MZW1_BCL2-01          --------------VEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A3P8YNB4_BCL2-01      YLTSSVAERRFREVIDELFRDGVNWGRIIAFFEFGGTICVECVNKE-MTS
A0A3P8WUE9_BCL2-01      YLTSSTAQRRFTEVIDELFRDGVNWGRIIAFFEFGGVVCVECAAKEDLTP
A0A3B4A3G8_BCL2-01      YLTSSTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASKEDMSS
A0A3Q3G1D7_BCL2-01      YLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECMSKQEMTS
A0A3Q2XQX2_BCL2-02      YLSSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECATKEDMTS
A0A3Q2XQX2_BCL2-01      YLSSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECATKEDMTS
A0A3Q3B0R2_BCL2-01      GLASAAAKARFAEVMDELFRDGVNWGRIIAFFEFGGTVCVECASREEMTP
A0A3Q2PN77_BCL2-01      YITRDTARTRFAEVVDELFRDGVNWGRIIAFFEFGGTVCVECASKEGMSS
A0A3P9J8Y9_BCL2-01      YLTSTTAKTRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASNEEMST
A0A3Q0S5Z7_BCL2-01      HLTSATAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASNEGMTS
A0A3P8QVM8_BCL2-01      HLTSSTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASNEGMSS
A0A3P9DIG5_BCL2-01      HLTSSTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASNEGMSS
A0A3Q2UYW8_BCL2-01      HLTSATAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASNEGMSS
A0A3B4G3K4_BCL2-01      HLTSATAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASNEGMSS
A0A2U9BJ09_BCL2-01      YLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECADTEEMTS
A0A3Q1I5N1_BCL2-01      YLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASKEEMTP
A0A3Q3K1K1_BCL2-01      HLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTMCVECAAKEEMTP
A0A3Q3MEY1_BCL2-01      YLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECAAKEEMTS
A0A1X9JZA1_BCL2-01      YLTSTTAQRRFADVIDELFRDGVNWGRIIAFFEFGGTVCVECVAKEEMAA
A0A4D6FTA2_BCL2-01      YLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECVAKEEMTP
A0A3Q1FLK7_BCL2-01      YLTTTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECAAKEEMTS
A0A3Q1B8C3_BCL2-01      YLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECAAKEEMTS
A0A3P8S9L3_BCL2-01      YLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECAAKEEMTS
A0A3B5BBQ0_BCL2-01      YLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECAAKEEMTS
A0A3B4TX71_BCL2-01      YLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECAAKEEMTS
A0A3B4YAG2_BCL2-01      YLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECAAKEEMTS
G1TW27_BCL2-02          HLTPFHARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A3B3TCS4_BCL2-01      HITPSTAQRRFTAVIEELFSDGVNWGRIVAFLEFGGTMCVESVNRE-MTS
A0A0U3DHY6_BCL2-01      HFTPSTAQXRFTAVIDELFSDGVNWGRIVAFFEFGGTMCVESVNRE-MTS
A0A3P9AAB2_BCL2-01      HITPSTAHGRFTAVIDELFSDGVNWGRIVAFLEFGGTMCVESVNRE-MTP
X4ZGI8_BCL2-01          TFSPSAAQRSFLAVAEELFRDGVNWGRIVAFFEFGGTMCVESFNRE-MAS
B9ZYL7_BCL2-01          HLTPSTVRVRFATVVEELFHDGVNWGRIVAFFEFGGVMCVEIVNRE-MSP
F6YNL8_BCL2-01          HLTPVTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A218UQA0_BCL2-01      HLTPFTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MFP
Q00709_BCL2-01          HLTPFTAHGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A493T1X3_BCL2-01      HLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
U3KEW4_BCL2-01          HLTPFTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
G3WZW9_BCL2-01          HLTPVTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
M3YYK3_BCL2-01          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
M3X1R9_BCL2-02          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A2K6R2I5_BCL2-02      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A2R9APW6_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
G3SLZ1_BCL2-01          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
Q75SV7_BCL2-01          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
M3X1R9_BCL2-01          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
Q8I008_BCL2-01          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVEGVNRE-MSP
A0A076FU27_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVICVESVNRE-MSP
A0A4P8GLJ2_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
F6R2C4_BCL2-01          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
O02718_BCL2-01          HLTPFTARERFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A076FZV9_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A452EV13_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A250YD83_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A9QXG9_BCL2-01          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A2K5NZS5_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A0D9S017_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A2K6CIX3_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A2K5XRD4_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A2K6KHG1_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A2K6R2I5_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A2K5HK49_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
G3QES9_BCL2-01          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
H2QEM8_BCL2-01          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A2I3GZF9_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A2K6UEL3_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
E2QWA1_BCL2-01          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
G1LIC9_BCL2-01          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A452R110_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A452R110_BCL2-02      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
G3WZW9_BCL2-02          HLTPVTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
G3SLZ1_BCL2-02          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A452T603_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
Q564A4_BCL2-01          VFNPNSAQRSFLTVAEELFRDGVNWGRIIAFFEFGGTMCVESVNRE-MAS
H9GPE7_BCL2-01          HLTPSTARSRFVAVVEELFQDGVNWGRIVAFFEFGGMLCVESVSRE-MSP
A0A452I9V7_BCL2-01      HLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
W5N4F7_BCL2-01          HFTPNTARRKFTAVVEELFRDGVNWGRIVAFFEFGGTMCVESVNRE-MTS
K7F5Y3_BCL2-02          HLTPFTARGRFVAVVEELFRDGINWGRIVAFFEFGGVMCVESVNRE-MSP
A0A3Q2HRY3_BCL2-02      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
K7F5Y3_BCL2-01          HLTPFTARGRFVAVVEELFRDGINWGRIVAFFEFGGVMCVESVNRE-MSP
F1LNV0_BCL2-01          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
P49950_BCL2-01          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVGSVNRE-MSP
G1TW27_BCL2-01          HLTPFHARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A2K5EB04_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A2R8MY14_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
H2NWH5_BCL2-01          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A096MPU7_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A2K5PP81_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
H0WKI0_BCL2-01          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A2K5UDI5_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
P10417_BCL2-01          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
Q7TSN8_BCL2-01          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A3Q2HRY3_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
E2QWA1_BCL2-02          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
A0A2K6G3I7_BCL2-01      HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
Q6R755_BCL2-01          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
Q9JJV8_BCL2-01          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
Q923R6_BCL2-01          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
H0W1T3_BCL2-01          HLTPFTARGRFAT----LFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
G1LIC9_BCL2-02          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
I3MVK9_BCL2-01          HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE-MSP
                                         ** **:*****:**:**** :**     : : .

G1MZW1_BCL2-01          LVDNIATWMTEYLNRHLHNWIQDNGGW-----------------------
A0A3P8YNB4_BCL2-01      QVDHIAGWMTEYLNGPLHSWIQENGGW-----------------------
A0A3P8WUE9_BCL2-01      QVEQVVDWMTEYLNGPLNIWIKENGGW-----------------------
A0A3B4A3G8_BCL2-01      QVDNIADWMTEYLNGTLSSWIQDNGGW-----------------------
A0A3Q3G1D7_BCL2-01      QVDNIAEWMTEYLNGPLNSWIQDNGGW-----------------------
A0A3Q2XQX2_BCL2-02      QVDNIAEWMTEYLNGPLGSWIQDNGGW-----------------------
A0A3Q2XQX2_BCL2-01      QVDNIAEWMTEYLNGPLGSWIQDNGGW-----------------------
A0A3Q3B0R2_BCL2-01      QVDHIAEWMTEYLNGPLNSWIEDNGGW-----------------------
A0A3Q2PN77_BCL2-01      QVDNIAEWMTEYLNGPLGSWIQDNGGW-----------------------
A0A3P9J8Y9_BCL2-01      QVASIAEWMTEYLNGPLNSWIEENGGW-----------------------
A0A3Q0S5Z7_BCL2-01      QVDNIAEWMTEYLNGPLNSWIQDNGGW-----------------------
A0A3P8QVM8_BCL2-01      QVDNIADWMTEYLNGPLNSWIQDNGGW-----------------------
A0A3P9DIG5_BCL2-01      QVDNIADWMTEYLNGPLNSWIQDNGGW-----------------------
A0A3Q2UYW8_BCL2-01      QVDNIADWMTEYLNGPLNSWIQDNGGW-----------------------
A0A3B4G3K4_BCL2-01      QVDNIADWMTEYLNGPLNSWIQDNGGW-----------------------
A0A2U9BJ09_BCL2-01      QVDNIAEWMTEYLNGPLNSWIMDNGGW-----------------------
A0A3Q1I5N1_BCL2-01      QVNNIAEWMTEYLNGPLHSWIQDNGGW-----------------------
A0A3Q3K1K1_BCL2-01      QVDKIAEWMTEYLNGPLNSWIQENGGW-----------------------
A0A3Q3MEY1_BCL2-01      QVDNIAEWMTEYLNGPLNSWIQDNGGW-----------------------
A0A1X9JZA1_BCL2-01      QVNNIAEWMTEYLNGPLNSWIQDNGGW-----------------------
A0A4D6FTA2_BCL2-01      QVDNIAEWMTEYLNGPLNSWIQDNGGW-----------------------
A0A3Q1FLK7_BCL2-01      QVDNIAEWMTEYLNGPLNSWIQDNGGW-----------------------
A0A3Q1B8C3_BCL2-01      QVDNIAEWMTEYLNGPLNSWIQDNGGW-----------------------
A0A3P8S9L3_BCL2-01      QVDNIAEWMTEYLNGPLNSWIQDNGGW-----------------------
A0A3B5BBQ0_BCL2-01      QVDNIAEWMTEYLNGPLNSWIQDNGGW-----------------------
A0A3B4TX71_BCL2-01      QVDNIVEWMTEYLNGPLNSWIKDNGGW-----------------------
A0A3B4YAG2_BCL2-01      QVDNIVEWMTEYLNGPLNSWIKDNGGW-----------------------
G1TW27_BCL2-02          LVDNIALWMTEYLNRHLHTWIQDNGGWADKSPWISGCLCTSRRATPGAHS
A0A3B3TCS4_BCL2-01      QVDNIAHWMTEYLNGPLHNWIQENGGW-----------------------
A0A0U3DHY6_BCL2-01      QVDNIALWMTEYLNGPLQNWIQENGGW-----------------------
A0A3P9AAB2_BCL2-01      QVNNIVHWMTEYLNGPLQNWIQENGGW-----------------------
X4ZGI8_BCL2-01          QVDNIAHWMTDYLNGPLENWIEENGGW-----------------------
B9ZYL7_BCL2-01          LVDSIVGWMTEYLNRHLQNWIQEQ--------------------------
F6YNL8_BCL2-01          LVDSIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A218UQA0_BCL2-01      LVDNIATWMTEYLNRHLHNWIQDNGGW-----------------------
Q00709_BCL2-01          LVDNIATWMTEYLNRHLHNWIQDNGGW-----------------------
A0A493T1X3_BCL2-01      LVDSIAAWMTEYLNRHLHNWIQDNGGW-----------------------
U3KEW4_BCL2-01          LVDSIAAWMTEYLNRHLHNWIQDNGGW-----------------------
G3WZW9_BCL2-01          LVDSIALWMTEYLNRHLHNWIQDNGGW-----------------------
M3YYK3_BCL2-01          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
M3X1R9_BCL2-02          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A2K6R2I5_BCL2-02      LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A2R9APW6_BCL2-01      LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
G3SLZ1_BCL2-01          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
Q75SV7_BCL2-01          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
M3X1R9_BCL2-01          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
Q8I008_BCL2-01          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A076FU27_BCL2-01      LVDSIALWMTEYLNRHLHAWIQDNGGW-----------------------
A0A4P8GLJ2_BCL2-01      LVDSIALWMTEYLNRHLHTWIQDNGGW-----------------------
F6R2C4_BCL2-01          LVDSIALWMTEYLNRHLHTWIQDNGGW-----------------------
O02718_BCL2-01          LVDSIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A076FZV9_BCL2-01      LVDSIALWMTEYLNRHLHAWIQDNGGW-----------------------
A0A452EV13_BCL2-01      LVDSIALWMTEYLNRHLHAWIQDNGGW-----------------------
A0A250YD83_BCL2-01      LVDNIALWMIEYLNRHLHTWIQDNGGW-----------------------
A9QXG9_BCL2-01          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A2K5NZS5_BCL2-01      LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A0D9S017_BCL2-01      LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A2K6CIX3_BCL2-01      LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A2K5XRD4_BCL2-01      LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A2K6KHG1_BCL2-01      LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A2K6R2I5_BCL2-01      LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A2K5HK49_BCL2-01      LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
G3QES9_BCL2-01          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
H2QEM8_BCL2-01          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A2I3GZF9_BCL2-01      LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A2K6UEL3_BCL2-01      LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
E2QWA1_BCL2-01          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
G1LIC9_BCL2-01          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A452R110_BCL2-01      LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A452R110_BCL2-02      LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
G3WZW9_BCL2-02          LVDSIALWMTEYLNRHLHNWIQDNGGW-----------------------
G3SLZ1_BCL2-02          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A452T603_BCL2-01      LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
Q564A4_BCL2-01          QVDNIAHWMTDYLNGPLENWIEENGGW-----------------------
H9GPE7_BCL2-01          LVDNIATWMTEYLNQYLRNWIQENGGW-----------------------
A0A452I9V7_BCL2-01      LVDSIAVWMTEYLNRHLHNWIQDNGGW-----------------------
W5N4F7_BCL2-01          QVDNIANWMTEYLNGPLQNWIQENGGW-----------------------
K7F5Y3_BCL2-02          LVDSIAVWMTEYLNRHLHNWIQDNGGW-----------------------
A0A3Q2HRY3_BCL2-02      LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
K7F5Y3_BCL2-01          LVDSIAVWMTEYLNRHLHNWIQDNGGW-----------------------
F1LNV0_BCL2-01          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
P49950_BCL2-01          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
G1TW27_BCL2-01          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A2K5EB04_BCL2-01      LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A2R8MY14_BCL2-01      LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
H2NWH5_BCL2-01          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A096MPU7_BCL2-01      LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A2K5PP81_BCL2-01      LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
H0WKI0_BCL2-01          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A2K5UDI5_BCL2-01      LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
P10417_BCL2-01          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
Q7TSN8_BCL2-01          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A3Q2HRY3_BCL2-01      LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
E2QWA1_BCL2-02          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
A0A2K6G3I7_BCL2-01      LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
Q6R755_BCL2-01          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
Q9JJV8_BCL2-01          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
Q923R6_BCL2-01          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
H0W1T3_BCL2-01          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
G1LIC9_BCL2-02          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
I3MVK9_BCL2-01          LVDNIALWMTEYLNRHLHTWIQDNGGW-----------------------
                         *  :. ** :***  *  ** ::                          

G1MZW1_BCL2-01          --------------------------------------------------
A0A3P8YNB4_BCL2-01      --------------------------------------------------
A0A3P8WUE9_BCL2-01      --------------------------------------------------
A0A3B4A3G8_BCL2-01      --------------------------------------------------
A0A3Q3G1D7_BCL2-01      --------------------------------------------------
A0A3Q2XQX2_BCL2-02      --------------------------------------------------
A0A3Q2XQX2_BCL2-01      --------------------------------------------------
A0A3Q3B0R2_BCL2-01      --------------------------------------------------
A0A3Q2PN77_BCL2-01      --------------------------------------------------
A0A3P9J8Y9_BCL2-01      --------------------------------------------------
A0A3Q0S5Z7_BCL2-01      --------------------------------------------------
A0A3P8QVM8_BCL2-01      --------------------------------------------------
A0A3P9DIG5_BCL2-01      --------------------------------------------------
A0A3Q2UYW8_BCL2-01      --------------------------------------------------
A0A3B4G3K4_BCL2-01      --------------------------------------------------
A0A2U9BJ09_BCL2-01      --------------------------------------------------
A0A3Q1I5N1_BCL2-01      --------------------------------------------------
A0A3Q3K1K1_BCL2-01      --------------------------------------------------
A0A3Q3MEY1_BCL2-01      --------------------------------------------------
A0A1X9JZA1_BCL2-01      --------------------------------------------------
A0A4D6FTA2_BCL2-01      --------------------------------------------------
A0A3Q1FLK7_BCL2-01      --------------------------------------------------
A0A3Q1B8C3_BCL2-01      --------------------------------------------------
A0A3P8S9L3_BCL2-01      --------------------------------------------------
A0A3B5BBQ0_BCL2-01      --------------------------------------------------
A0A3B4TX71_BCL2-01      --------------------------------------------------
A0A3B4YAG2_BCL2-01      --------------------------------------------------
G1TW27_BCL2-02          LTEGSATSSASLYSAQHREAWHGFCWNEKIGRAALDNSTAKHCGRRFGLH
A0A3B3TCS4_BCL2-01      --------------------------------------------------
A0A0U3DHY6_BCL2-01      --------------------------------------------------
A0A3P9AAB2_BCL2-01      --------------------------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
B9ZYL7_BCL2-01          --------------------------------------------------
F6YNL8_BCL2-01          --------------------------------------------------
A0A218UQA0_BCL2-01      --------------------------------------------------
Q00709_BCL2-01          --------------------------------------------------
A0A493T1X3_BCL2-01      --------------------------------------------------
U3KEW4_BCL2-01          --------------------------------------------------
G3WZW9_BCL2-01          --------------------------------------------------
M3YYK3_BCL2-01          --------------------------------------------------
M3X1R9_BCL2-02          --------------------------------------------------
A0A2K6R2I5_BCL2-02      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
G3SLZ1_BCL2-01          --------------------------------------------------
Q75SV7_BCL2-01          --------------------------------------------------
M3X1R9_BCL2-01          --------------------------------------------------
Q8I008_BCL2-01          --------------------------------------------------
A0A076FU27_BCL2-01      --------------------------------------------------
A0A4P8GLJ2_BCL2-01      --------------------------------------------------
F6R2C4_BCL2-01          --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A076FZV9_BCL2-01      --------------------------------------------------
A0A452EV13_BCL2-01      --------------------------------------------------
A0A250YD83_BCL2-01      --------------------------------------------------
A9QXG9_BCL2-01          --------------------------------------------------
A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A0D9S017_BCL2-01      --------------------------------------------------
A0A2K6CIX3_BCL2-01      --------------------------------------------------
A0A2K5XRD4_BCL2-01      --------------------------------------------------
A0A2K6KHG1_BCL2-01      --------------------------------------------------
A0A2K6R2I5_BCL2-01      --------------------------------------------------
A0A2K5HK49_BCL2-01      --------------------------------------------------
G3QES9_BCL2-01          --------------------------------------------------
H2QEM8_BCL2-01          --------------------------------------------------
A0A2I3GZF9_BCL2-01      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
E2QWA1_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-01          --------------------------------------------------
A0A452R110_BCL2-01      --------------------------------------------------
A0A452R110_BCL2-02      --------------------------------------------------
G3WZW9_BCL2-02          --------------------------------------------------
G3SLZ1_BCL2-02          --------------------------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
Q564A4_BCL2-01          --------------------------------------------------
H9GPE7_BCL2-01          --------------------------------------------------
A0A452I9V7_BCL2-01      --------------------------------------------------
W5N4F7_BCL2-01          --------------------------------------------------
K7F5Y3_BCL2-02          --------------------------------------------------
A0A3Q2HRY3_BCL2-02      --------------------------------------------------
K7F5Y3_BCL2-01          --------------------------------------------------
F1LNV0_BCL2-01          --------------------------------------------------
P49950_BCL2-01          --------------------------------------------------
G1TW27_BCL2-01          --------------------------------------------------
A0A2K5EB04_BCL2-01      --------------------------------------------------
A0A2R8MY14_BCL2-01      --------------------------------------------------
H2NWH5_BCL2-01          --------------------------------------------------
A0A096MPU7_BCL2-01      --------------------------------------------------
A0A2K5PP81_BCL2-01      --------------------------------------------------
H0WKI0_BCL2-01          --------------------------------------------------
A0A2K5UDI5_BCL2-01      --------------------------------------------------
P10417_BCL2-01          --------------------------------------------------
Q7TSN8_BCL2-01          --------------------------------------------------
A0A3Q2HRY3_BCL2-01      --------------------------------------------------
E2QWA1_BCL2-02          --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
Q6R755_BCL2-01          --------------------------------------------------
Q9JJV8_BCL2-01          --------------------------------------------------
Q923R6_BCL2-01          --------------------------------------------------
H0W1T3_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-02          --------------------------------------------------
I3MVK9_BCL2-01          --------------------------------------------------
                                                                          

G1MZW1_BCL2-01          --------------------------------------------------
A0A3P8YNB4_BCL2-01      --------------------------------------------------
A0A3P8WUE9_BCL2-01      --------------------------------------------------
A0A3B4A3G8_BCL2-01      --------------------------------------------------
A0A3Q3G1D7_BCL2-01      --------------------------------------------------
A0A3Q2XQX2_BCL2-02      --------------------------------------------------
A0A3Q2XQX2_BCL2-01      --------------------------------------------------
A0A3Q3B0R2_BCL2-01      --------------------------------------------------
A0A3Q2PN77_BCL2-01      --------------------------------------------------
A0A3P9J8Y9_BCL2-01      --------------------------------------------------
A0A3Q0S5Z7_BCL2-01      --------------------------------------------------
A0A3P8QVM8_BCL2-01      --------------------------------------------------
A0A3P9DIG5_BCL2-01      --------------------------------------------------
A0A3Q2UYW8_BCL2-01      --------------------------------------------------
A0A3B4G3K4_BCL2-01      --------------------------------------------------
A0A2U9BJ09_BCL2-01      --------------------------------------------------
A0A3Q1I5N1_BCL2-01      --------------------------------------------------
A0A3Q3K1K1_BCL2-01      --------------------------------------------------
A0A3Q3MEY1_BCL2-01      --------------------------------------------------
A0A1X9JZA1_BCL2-01      --------------------------------------------------
A0A4D6FTA2_BCL2-01      --------------------------------------------------
A0A3Q1FLK7_BCL2-01      --------------------------------------------------
A0A3Q1B8C3_BCL2-01      --------------------------------------------------
A0A3P8S9L3_BCL2-01      --------------------------------------------------
A0A3B5BBQ0_BCL2-01      --------------------------------------------------
A0A3B4TX71_BCL2-01      --------------------------------------------------
A0A3B4YAG2_BCL2-01      --------------------------------------------------
G1TW27_BCL2-02          TKAAKVLIAFSVIAKKALNSSLHVFRMTDFCSASSEHSASHGKERLDLRG
A0A3B3TCS4_BCL2-01      --------------------------------------------------
A0A0U3DHY6_BCL2-01      --------------------------------------------------
A0A3P9AAB2_BCL2-01      --------------------------------------------------
X4ZGI8_BCL2-01          --------------------------------------------------
B9ZYL7_BCL2-01          --------------------------------------------------
F6YNL8_BCL2-01          --------------------------------------------------
A0A218UQA0_BCL2-01      --------------------------------------------------
Q00709_BCL2-01          --------------------------------------------------
A0A493T1X3_BCL2-01      --------------------------------------------------
U3KEW4_BCL2-01          --------------------------------------------------
G3WZW9_BCL2-01          --------------------------------------------------
M3YYK3_BCL2-01          --------------------------------------------------
M3X1R9_BCL2-02          --------------------------------------------------
A0A2K6R2I5_BCL2-02      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
G3SLZ1_BCL2-01          --------------------------------------------------
Q75SV7_BCL2-01          --------------------------------------------------
M3X1R9_BCL2-01          --------------------------------------------------
Q8I008_BCL2-01          --------------------------------------------------
A0A076FU27_BCL2-01      --------------------------------------------------
A0A4P8GLJ2_BCL2-01      --------------------------------------------------
F6R2C4_BCL2-01          --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A076FZV9_BCL2-01      --------------------------------------------------
A0A452EV13_BCL2-01      --------------------------------------------------
A0A250YD83_BCL2-01      --------------------------------------------------
A9QXG9_BCL2-01          --------------------------------------------------
A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A0D9S017_BCL2-01      --------------------------------------------------
A0A2K6CIX3_BCL2-01      --------------------------------------------------
A0A2K5XRD4_BCL2-01      --------------------------------------------------
A0A2K6KHG1_BCL2-01      --------------------------------------------------
A0A2K6R2I5_BCL2-01      --------------------------------------------------
A0A2K5HK49_BCL2-01      --------------------------------------------------
G3QES9_BCL2-01          --------------------------------------------------
H2QEM8_BCL2-01          --------------------------------------------------
A0A2I3GZF9_BCL2-01      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
E2QWA1_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-01          --------------------------------------------------
A0A452R110_BCL2-01      --------------------------------------------------
A0A452R110_BCL2-02      --------------------------------------------------
G3WZW9_BCL2-02          --------------------------------------------------
G3SLZ1_BCL2-02          --------------------------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
Q564A4_BCL2-01          --------------------------------------------------
H9GPE7_BCL2-01          --------------------------------------------------
A0A452I9V7_BCL2-01      --------------------------------------------------
W5N4F7_BCL2-01          --------------------------------------------------
K7F5Y3_BCL2-02          --------------------------------------------------
A0A3Q2HRY3_BCL2-02      --------------------------------------------------
K7F5Y3_BCL2-01          --------------------------------------------------
F1LNV0_BCL2-01          --------------------------------------------------
P49950_BCL2-01          --------------------------------------------------
G1TW27_BCL2-01          --------------------------------------------------
A0A2K5EB04_BCL2-01      --------------------------------------------------
A0A2R8MY14_BCL2-01      --------------------------------------------------
H2NWH5_BCL2-01          --------------------------------------------------
A0A096MPU7_BCL2-01      --------------------------------------------------
A0A2K5PP81_BCL2-01      --------------------------------------------------
H0WKI0_BCL2-01          --------------------------------------------------
A0A2K5UDI5_BCL2-01      --------------------------------------------------
P10417_BCL2-01          --------------------------------------------------
Q7TSN8_BCL2-01          --------------------------------------------------
A0A3Q2HRY3_BCL2-01      --------------------------------------------------
E2QWA1_BCL2-02          --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
Q6R755_BCL2-01          --------------------------------------------------
Q9JJV8_BCL2-01          --------------------------------------------------
Q923R6_BCL2-01          --------------------------------------------------
H0W1T3_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-02          --------------------------------------------------
I3MVK9_BCL2-01          --------------------------------------------------
                                                                          

G1MZW1_BCL2-01          -------------------DAFVELYGT-----------SMRPLFDF---
A0A3P8YNB4_BCL2-01      -------------------EAFVELYDR-----------QRDSVF-C---
A0A3P8WUE9_BCL2-01      -------------------DAFVELYDR-----------QGESAFSC---
A0A3B4A3G8_BCL2-01      -------------------EAFVELYDR-----------QRDSVFSC---
A0A3Q3G1D7_BCL2-01      -------------------DAFVELYDR-----------QRDSAFCS---
A0A3Q2XQX2_BCL2-02      -------------------DAFVELYDR-----------QRDSVFSC---
A0A3Q2XQX2_BCL2-01      -------------------DAFVELYDR-----------QRDSVFSC---
A0A3Q3B0R2_BCL2-01      -------------------DAFVELYDR-----------HKESVFSC---
A0A3Q2PN77_BCL2-01      -------------------DAFVELYDR-----------QKESIFSC---
A0A3P9J8Y9_BCL2-01      -------------------DAFVELYDR-----------QKETVFSC---
A0A3Q0S5Z7_BCL2-01      -------------------DAFVELYGR-----------QRESVFSC---
A0A3P8QVM8_BCL2-01      -------------------DAFVELYDR-----------QRDSVFSC---
A0A3P9DIG5_BCL2-01      -------------------DAFVELYDR-----------QRDSVFSC---
A0A3Q2UYW8_BCL2-01      -------------------DAFVELYDR-----------QRDSVFSC---
A0A3B4G3K4_BCL2-01      -------------------DAFVELYDR-----------QRDSVFSC---
A0A2U9BJ09_BCL2-01      -------------------DAFVELYDR-----------HGESVFSC---
A0A3Q1I5N1_BCL2-01      -------------------DAFVDLYDR-----------QRESVFSC---
A0A3Q3K1K1_BCL2-01      -------------------DAFVELYDR-----------QRESVFSC---
A0A3Q3MEY1_BCL2-01      -------------------DAFVEMYDR-----------QRESVFSC---
A0A1X9JZA1_BCL2-01      -------------------DAFVELYDR-----------QRDSVFSC---
A0A4D6FTA2_BCL2-01      -------------------DAFVELYDR-----------QRDSVFSC---
A0A3Q1FLK7_BCL2-01      -------------------DAFVELYDR-----------QRDSVFSC---
A0A3Q1B8C3_BCL2-01      -------------------DAFVELYDR-----------QRDSVFSC---
A0A3P8S9L3_BCL2-01      -------------------DAFVELYDR-----------QRDSVFSC---
A0A3B5BBQ0_BCL2-01      -------------------DAFVELYDR-----------QRDSVFSC---
A0A3B4TX71_BCL2-01      -------------------DAFVELYDR-----------QRESVFSC---
A0A3B4YAG2_BCL2-01      -------------------DAFVELYDR-----------QRESVFSC---
G1TW27_BCL2-02          KTQKTDDGSQLVLQKEFPVNCFGTVEGQKQSKDVLPCIYIIYEAFSH---
A0A3B3TCS4_BCL2-01      -------------------DAFVEIYGQ-----------QRGSVMA----
A0A0U3DHY6_BCL2-01      -------------------DAFVEIYEQ-----------QR--ISH----
A0A3P9AAB2_BCL2-01      -------------------DAFVEIYGQ-----------KRGSLFH----
X4ZGI8_BCL2-01          -------------------DAFVELYSQ-----------QRDPMFHP---
B9ZYL7_BCL2-01          -------------------DAFVELYNS-----------NIQPPFDQ---
F6YNL8_BCL2-01          -------------------VGA----------------------------
A0A218UQA0_BCL2-01      -------------------DAFVELYGN-----------NMRPLFDF---
Q00709_BCL2-01          -------------------DAFVELYGN-----------SMRPLFDF---
A0A493T1X3_BCL2-01      -------------------DAFVELYGN-----------SMRPLFDF---
U3KEW4_BCL2-01          -------------------DAFVELYGN-----------SMRPLFDF---
G3WZW9_BCL2-01          -------------------GTKAICMGT-----------S--GPFQV---
M3YYK3_BCL2-01          -------------------PAPAPHEGP-----------AARPIVDD---
M3X1R9_BCL2-02          -------------------LILL-------------------PRTSY---
A0A2K6R2I5_BCL2-02      -------------------RTMC---------------------------
A0A2R9APW6_BCL2-01      -------------------DAFVELYGP-----------SMRPLFDF---
G3SLZ1_BCL2-01          -------------------DAFVELYGP-----------NMRPLFDF---
Q75SV7_BCL2-01          -------------------DAFVELYGP-----------TMQPLFDF---
M3X1R9_BCL2-01          -------------------DAFVELYGP-----------SMQPLFDF---
Q8I008_BCL2-01          -------------------DAFVELYGP-----------SMQPLFDF---
A0A076FU27_BCL2-01      -------------------DAFVELYGP-----------SMRPLFDF---
A0A4P8GLJ2_BCL2-01      -------------------DAFVELYGP-----------SMRPLFDF---
F6R2C4_BCL2-01          -------------------DAFVELYGP-----------SMRPLFDF---
O02718_BCL2-01          -------------------DAFVELYGP-----------SMRPLFDF---
A0A076FZV9_BCL2-01      -------------------DAFVELYGP-----------SMRPLFDF---
A0A452EV13_BCL2-01      -------------------DAFVELYGP-----------SMRPLFDF---
A0A250YD83_BCL2-01      -------------------DAFVELYGP-----------SVRPLFDF---
A9QXG9_BCL2-01          -------------------DAFVELYGP-----------SMRPLFDF---
A0A2K5NZS5_BCL2-01      -------------------DAFVELYGP-----------SMRPLFDF---
A0A0D9S017_BCL2-01      -------------------DAFVELYGP-----------SMRPLFDF---
A0A2K6CIX3_BCL2-01      -------------------DAFVELYGP-----------SMRPLFDF---
A0A2K5XRD4_BCL2-01      -------------------DAFVELYGP-----------SMRPLFDF---
A0A2K6KHG1_BCL2-01      -------------------DAFVELYGP-----------SMRPLFDF---
A0A2K6R2I5_BCL2-01      -------------------DAFVELYGP-----------SMRPLFDF---
A0A2K5HK49_BCL2-01      -------------------DAFVELYGP-----------SMWPLFDF---
G3QES9_BCL2-01          -------------------DAFVELYGP-----------SMRPLFDF---
H2QEM8_BCL2-01          -------------------DAFVELYGP-----------SMRPLFDF---
A0A2I3GZF9_BCL2-01      -------------------DAFVELYGP-----------SMRPLFDF---
A0A2K6UEL3_BCL2-01      -------------------DAFVELYGP-----------SMRPLFDF---
E2QWA1_BCL2-01          -------------------DAFVELYGP-----------TMQPLFDF---
G1LIC9_BCL2-01          -------------------DAFVELYGP-----------SMQPLFDF---
A0A452R110_BCL2-01      -------------------DAFVELYGP-----------SMQPLFDF---
A0A452R110_BCL2-02      -------------------AH-----------------------------
G3WZW9_BCL2-02          -------------------VGVSA--------------------------
G3SLZ1_BCL2-02          -------------------VGACVVE------------------------
A0A452T603_BCL2-01      -------------------VGARPLECA-----------SGLHVSNL---
Q564A4_BCL2-01          -------------------DAFVEMYGQ-----------QRDSVFH----
H9GPE7_BCL2-01          --------------------------------------------------
A0A452I9V7_BCL2-01      --------------------------------------------------
W5N4F7_BCL2-01          -------------------DAFVELYGR-----------QRGSMFSC---
K7F5Y3_BCL2-02          -------------------AGAVSVL------------------------
A0A3Q2HRY3_BCL2-02      -------------------QLCQAPTGSQEMFSGGWTIHSGSPLQNLCVS
K7F5Y3_BCL2-01          -------------------DAFVELYGS-----------NMRPLFDF---
F1LNV0_BCL2-01          -------------------DAFVELYGP-----------SMRPLFDF---
P49950_BCL2-01          -------------------DAFVELYGP-----------SMRPLFDF---
G1TW27_BCL2-01          -------------------DAFVELYGP-----------SVRPLSDF---
A0A2K5EB04_BCL2-01      -------------------DAFVELYGP-----------SMRPLFDF---
A0A2R8MY14_BCL2-01      -------------------DAFVELYGP-----------SMRPLFDF---
H2NWH5_BCL2-01          -------------------DAFVELYGP-----------SMRPLFDF---
A0A096MPU7_BCL2-01      -------------------DAFVELYGP-----------SMRPLFDF---
A0A2K5PP81_BCL2-01      -------------------DAFVELYGP-----------SMRPLFDF---
H0WKI0_BCL2-01          -------------------DAFVELYGP-----------SMRPLFDF---
A0A2K5UDI5_BCL2-01      -------------------DAFVELYGP-----------SMRPLFDF---
P10417_BCL2-01          -------------------DAFVELYGP-----------SMRPLFDF---
Q7TSN8_BCL2-01          -------------------DAFVELYGP-----------SMRPLFDF---
A0A3Q2HRY3_BCL2-01      -------------------DAFVELYGP-----------SMRPLFDF---
E2QWA1_BCL2-02          -------------------DAFVELYGP-----------TMQPLFDF---
A0A2K6G3I7_BCL2-01      -------------------DAFVELYGP-----------SMRPLFDF---
Q6R755_BCL2-01          -------------------DAFVELYGP-----------TMQPLFDF---
Q9JJV8_BCL2-01          -------------------DAFVELYGP-----------SVRPLFDF---
Q923R6_BCL2-01          -------------------DAFVELYGP-----------SVRPLFDF---
H0W1T3_BCL2-01          --------------------------------------------------
G1LIC9_BCL2-02          --------------------------------------------------
I3MVK9_BCL2-01          --------------------------------------------------
                                                                          

G1MZW1_BCL2-01          ---S-WISLKTILSLVLVG-----ACITLGAY-LGHK-------------
A0A3P8YNB4_BCL2-01      ---S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK-------------
A0A3P8WUE9_BCL2-01      ---S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK-------------
A0A3B4A3G8_BCL2-01      ---S-WPSIKTVFGLAAIGA----ASLTIGAY-LSQK-------------
A0A3Q3G1D7_BCL2-01      ---S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK-------------
A0A3Q2XQX2_BCL2-02      ---T-WPSIKTVFGLAALGA----ASLTIGAY-LTQK-------------
A0A3Q2XQX2_BCL2-01      ---T-WPSIKTVFGLAALGA----ASLTIGAY-LTQK-------------
A0A3Q3B0R2_BCL2-01      ---Y-WPSIKTVFGLAALGA----ASITIGAY-LTQKMPLTPQRQPSDQI
A0A3Q2PN77_BCL2-01      ---Y-WPSIKTVFGLAALGA----ASITIGAY-LAQK-------------
A0A3P9J8Y9_BCL2-01      ---Y-WPSIKTVFGLAALGA----ASLTIGAY-LAQK-------------
A0A3Q0S5Z7_BCL2-01      ---S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK-------------
A0A3P8QVM8_BCL2-01      ---S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK-------------
A0A3P9DIG5_BCL2-01      ---S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK-------------
A0A3Q2UYW8_BCL2-01      ---S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK-------------
A0A3B4G3K4_BCL2-01      ---S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK-------------
A0A2U9BJ09_BCL2-01      ---S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK-------------
A0A3Q1I5N1_BCL2-01      ---S-WSSIKTVFGLAALGA----ASLTIGAY-LAQK-------------
A0A3Q3K1K1_BCL2-01      ---S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK-------------
A0A3Q3MEY1_BCL2-01      ---S-WPSIKTVFGLAALGA----ASITIGAY-LTQK-------------
A0A1X9JZA1_BCL2-01      ---S-WPSIKTVFGVAALGA----ASLTIGAY-LTQK-------------
A0A4D6FTA2_BCL2-01      ---S-WPSIKTVFGMAALGA----ASLTIGAY-LTQK-------------
A0A3Q1FLK7_BCL2-01      ---S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK-------------
A0A3Q1B8C3_BCL2-01      ---S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK-------------
A0A3P8S9L3_BCL2-01      ---S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK-------------
A0A3B5BBQ0_BCL2-01      ---S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK-------------
A0A3B4TX71_BCL2-01      ---S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK-------------
A0A3B4YAG2_BCL2-01      ---S-WPSIKTVFGLAALGA----ASLTIGAY-LTQK-------------
G1TW27_BCL2-02          ---LEVLLYVLQWDLASCQLQFEPISFCIGFCVQGNLVSL----------
A0A3B3TCS4_BCL2-01      ---CFWPYLKTVFGLAALGA----VGVTISAY-FTKK-------------
A0A0U3DHY6_BCL2-01      ---S-WPYLKTVFGLAALGA----VGVTIGAL-FTQK-------------
A0A3P9AAB2_BCL2-01      ---S-WPFLKTMFSLAALGA----AGVTIGAM-FTQK-------------
X4ZGI8_BCL2-01          -----LSYLTKVLGLAALGL----AGVTIGAF-FAQK-------------
B9ZYL7_BCL2-01          ---S-WLSIKTILSLAVVG-----ACITIGGISLATK-------------
F6YNL8_BCL2-01          --------------------------------------------------
A0A218UQA0_BCL2-01      ---S-WISLKTILSLVLVG-----ACITLGAY-LGHK-------------
Q00709_BCL2-01          ---S-WISLKTILSLVLVG-----ACITLGAY-LGHK-------------
A0A493T1X3_BCL2-01      ---S-WISLKTILSLVLVG-----ACITLGAY-LGHK-------------
U3KEW4_BCL2-01          ---S-WISLKTILSLVLVG-----ACITLGAY-LGHK-------------
G3WZW9_BCL2-01          ---S----------------------------------------------
M3YYK3_BCL2-01          ---SYWPKVFSLLA------------------------------------
M3X1R9_BCL2-02          ---E-LKSSRALREDVRIS-----PSFLFKD-------------------
A0A2K6R2I5_BCL2-02      ---T-WCRFR------------------------GCD-------------
A0A2R9APW6_BCL2-01      ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
G3SLZ1_BCL2-01          ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
Q75SV7_BCL2-01          ---S-WLSLKALLSLALVG-----ACITLGAY-LGHK-------------
M3X1R9_BCL2-01          ---S-WLSLKALLSLALVG-----ACITLGAY-LGHK-------------
Q8I008_BCL2-01          ---S-WLSLKALLSLALVG-----ACITLGAY-LGHK-------------
A0A076FU27_BCL2-01      ---S-WLSLKALLSLALVG-----ACITLGAY-LGHK-------------
A0A4P8GLJ2_BCL2-01      ---S-WLSLKALLSLALVG-----ACITLGAY-LGHK-------------
F6R2C4_BCL2-01          ---S-WLSLKALLSLALVG-----ACITLGAY-LGHK-------------
O02718_BCL2-01          ---S-WLSLKALLSLALVG-----ACITLGAY-LGHK-------------
A0A076FZV9_BCL2-01      ---S-WLSLKALLSLALVG-----ACITLGAY-LGHK-------------
A0A452EV13_BCL2-01      ---S-WLSLKALLSLALVG-----ACITLGAY-LGHK-------------
A0A250YD83_BCL2-01      ---S-WLSLKTLLSLALVG-----VCITLGAY-LGHK-------------
A9QXG9_BCL2-01          ---S-WLSLKTLLSLALVG-----ACITLGAY-LSHK-------------
A0A2K5NZS5_BCL2-01      ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
A0A0D9S017_BCL2-01      ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
A0A2K6CIX3_BCL2-01      ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
A0A2K5XRD4_BCL2-01      ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
A0A2K6KHG1_BCL2-01      ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
A0A2K6R2I5_BCL2-01      ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
A0A2K5HK49_BCL2-01      ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
G3QES9_BCL2-01          ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
H2QEM8_BCL2-01          ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
A0A2I3GZF9_BCL2-01      ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
A0A2K6UEL3_BCL2-01      ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
E2QWA1_BCL2-01          ---S-WLSLKALLSLALVG-----ACITLGAY-LGHK-------------
G1LIC9_BCL2-01          ---S-WLSLKALLSLALVG-----ACITLGAY-LGHK-------------
A0A452R110_BCL2-01      ---S-WLSLKALLSLALVG-----ACITLGAY-LGHK-------------
A0A452R110_BCL2-02      --------------------------------------------------
G3WZW9_BCL2-02          --------------------------------------------------
G3SLZ1_BCL2-02          --------------------------------------------------
A0A452T603_BCL2-01      ---RLRIRGWSVGGLLGQG-----QTDEPGK-------------------
Q564A4_BCL2-01          ---P-FSYLTKVLGLAALGL----AGVTIGAF-FAQK-------------
H9GPE7_BCL2-01          --------------------------------------------------
A0A452I9V7_BCL2-01      ------------------------VCVQYFFL-FKLQ-------------
W5N4F7_BCL2-01          ---S-WPSLKTFFGLAALGA----AGLTVGAY-FTQK-------------
K7F5Y3_BCL2-02          --------------------------------------------------
A0A3Q2HRY3_BCL2-02      RAGN-WFSEKKNMTWCLTSDKDVIDRTPIRMY-QGRKSREAEIQSQCRPP
K7F5Y3_BCL2-01          ---S-WISLKTILSLALVG-----ACITLGAY-LGHK-------------
F1LNV0_BCL2-01          ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
P49950_BCL2-01          ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
G1TW27_BCL2-01          ---S-WVSLKTLFSLALIG-----ACITLGAY-LGHK-------------
A0A2K5EB04_BCL2-01      ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
A0A2R8MY14_BCL2-01      ---S-WLSLKTLLSLVLVG-----ACITLGAY-LGHK-------------
H2NWH5_BCL2-01          ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
A0A096MPU7_BCL2-01      ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
A0A2K5PP81_BCL2-01      ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
H0WKI0_BCL2-01          ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
A0A2K5UDI5_BCL2-01      ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
P10417_BCL2-01          ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
Q7TSN8_BCL2-01          ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
A0A3Q2HRY3_BCL2-01      ---S-WLSLKALLSLALVG-----ACITLGAY-LGHK-------------
E2QWA1_BCL2-02          ---S-WLSLKALLSLALVG-----ACITLGAY-LGHK-------------
A0A2K6G3I7_BCL2-01      ---S-WLSLKTLLSLALVG-----ACITLGAY-LGHK-------------
Q6R755_BCL2-01          ---S-WLSLKALLSLALVG-----ACITLGAY-LGHK-------------
Q9JJV8_BCL2-01          ---S-WLSLKTLLSLALVG-----ACITLGTY-LGHK-------------
Q923R6_BCL2-01          ---S-WLSLXTLLNLALVG-----ACITLGTY-LGHK-------------
H0W1T3_BCL2-01          -----------------VG-----ACLSE---------------------
G1LIC9_BCL2-02          -----------------VG-----ARPLE---------------------
I3MVK9_BCL2-01          -----------------VG-----ARRVE---------------------
                                                                          

G1MZW1_BCL2-01          ----------------------------------------------
A0A3P8YNB4_BCL2-01      ----------------------------------------------
A0A3P8WUE9_BCL2-01      ----------------------------------------------
A0A3B4A3G8_BCL2-01      ----------------------------------------------
A0A3Q3G1D7_BCL2-01      ----------------------------------------------
A0A3Q2XQX2_BCL2-02      ----------------------------------------------
A0A3Q2XQX2_BCL2-01      ----------------------------------------------
A0A3Q3B0R2_BCL2-01      WLSSKPRSENCFPPPAPPCQNRHKSKQQREPEARPREQRMSEVESH
A0A3Q2PN77_BCL2-01      ----------------------------------------------
A0A3P9J8Y9_BCL2-01      ----------------------------------------------
A0A3Q0S5Z7_BCL2-01      ----------------------------------------------
A0A3P8QVM8_BCL2-01      ----------------------------------------------
A0A3P9DIG5_BCL2-01      ----------------------------------------------
A0A3Q2UYW8_BCL2-01      ----------------------------------------------
A0A3B4G3K4_BCL2-01      ----------------------------------------------
A0A2U9BJ09_BCL2-01      ----------------------------------------------
A0A3Q1I5N1_BCL2-01      ----------------------------------------------
A0A3Q3K1K1_BCL2-01      ----------------------------------------------
A0A3Q3MEY1_BCL2-01      ----------------------------------------------
A0A1X9JZA1_BCL2-01      ----------------------------------------------
A0A4D6FTA2_BCL2-01      ----------------------------------------------
A0A3Q1FLK7_BCL2-01      ----------------------------------------------
A0A3Q1B8C3_BCL2-01      ----------------------------------------------
A0A3P8S9L3_BCL2-01      ----------------------------------------------
A0A3B5BBQ0_BCL2-01      ----------------------------------------------
A0A3B4TX71_BCL2-01      ----------------------------------------------
A0A3B4YAG2_BCL2-01      ----------------------------------------------
G1TW27_BCL2-02          ----------------------------------------------
A0A3B3TCS4_BCL2-01      ----------------------------------------------
A0A0U3DHY6_BCL2-01      ----------------------------------------------
A0A3P9AAB2_BCL2-01      ----------------------------------------------
X4ZGI8_BCL2-01          ----------------------------------------------
B9ZYL7_BCL2-01          ----------------------------------------------
F6YNL8_BCL2-01          ----------------------------------------------
A0A218UQA0_BCL2-01      ----------------------------------------------
Q00709_BCL2-01          ----------------------------------------------
A0A493T1X3_BCL2-01      ----------------------------------------------
U3KEW4_BCL2-01          ----------------------------------------------
G3WZW9_BCL2-01          ----------------------------------------------
M3YYK3_BCL2-01          ----------------------------------------------
M3X1R9_BCL2-02          ----------------------------------------------
A0A2K6R2I5_BCL2-02      ----------------------------------------------
A0A2R9APW6_BCL2-01      ----------------------------------------------
G3SLZ1_BCL2-01          ----------------------------------------------
Q75SV7_BCL2-01          ----------------------------------------------
M3X1R9_BCL2-01          ----------------------------------------------
Q8I008_BCL2-01          ----------------------------------------------
A0A076FU27_BCL2-01      ----------------------------------------------
A0A4P8GLJ2_BCL2-01      ----------------------------------------------
F6R2C4_BCL2-01          ----------------------------------------------
O02718_BCL2-01          ----------------------------------------------
A0A076FZV9_BCL2-01      ----------------------------------------------
A0A452EV13_BCL2-01      ----------------------------------------------
A0A250YD83_BCL2-01      ----------------------------------------------
A9QXG9_BCL2-01          ----------------------------------------------
A0A2K5NZS5_BCL2-01      ----------------------------------------------
A0A0D9S017_BCL2-01      ----------------------------------------------
A0A2K6CIX3_BCL2-01      ----------------------------------------------
A0A2K5XRD4_BCL2-01      ----------------------------------------------
A0A2K6KHG1_BCL2-01      ----------------------------------------------
A0A2K6R2I5_BCL2-01      ----------------------------------------------
A0A2K5HK49_BCL2-01      ----------------------------------------------
G3QES9_BCL2-01          ----------------------------------------------
H2QEM8_BCL2-01          ----------------------------------------------
A0A2I3GZF9_BCL2-01      ----------------------------------------------
A0A2K6UEL3_BCL2-01      ----------------------------------------------
E2QWA1_BCL2-01          ----------------------------------------------
G1LIC9_BCL2-01          ----------------------------------------------
A0A452R110_BCL2-01      ----------------------------------------------
A0A452R110_BCL2-02      ----------------------------------------------
G3WZW9_BCL2-02          ----------------------------------------------
G3SLZ1_BCL2-02          ----------------------------------------------
A0A452T603_BCL2-01      ----------------------------------------------
Q564A4_BCL2-01          ----------------------------------------------
H9GPE7_BCL2-01          ----------------------------------------------
A0A452I9V7_BCL2-01      ----------------------------------------------
W5N4F7_BCL2-01          ----------------------------------------------
K7F5Y3_BCL2-02          ----------------------------------------------
A0A3Q2HRY3_BCL2-02      CMLLHLLEIQVPVLFLSE----------------------------
K7F5Y3_BCL2-01          ----------------------------------------------
F1LNV0_BCL2-01          ----------------------------------------------
P49950_BCL2-01          ----------------------------------------------
G1TW27_BCL2-01          ----------------------------------------------
A0A2K5EB04_BCL2-01      ----------------------------------------------
A0A2R8MY14_BCL2-01      ----------------------------------------------
H2NWH5_BCL2-01          ----------------------------------------------
A0A096MPU7_BCL2-01      ----------------------------------------------
A0A2K5PP81_BCL2-01      ----------------------------------------------
H0WKI0_BCL2-01          ----------------------------------------------
A0A2K5UDI5_BCL2-01      ----------------------------------------------
P10417_BCL2-01          ----------------------------------------------
Q7TSN8_BCL2-01          ----------------------------------------------
A0A3Q2HRY3_BCL2-01      ----------------------------------------------
E2QWA1_BCL2-02          ----------------------------------------------
A0A2K6G3I7_BCL2-01      ----------------------------------------------
Q6R755_BCL2-01          ----------------------------------------------
Q9JJV8_BCL2-01          ----------------------------------------------
Q923R6_BCL2-01          ----------------------------------------------
H0W1T3_BCL2-01          ----------------------------------------------
G1LIC9_BCL2-02          ----------------------------------------------
I3MVK9_BCL2-01          ----------------------------------------------
                                                                      

© 1998-2020Legal notice