Dataset for protein BCL-2-like of organism Takifugu rubripes

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B5KD08_BCL2L10      ----------------MSCGLWKETLALAEDY----------------LS
H2U5I3_BCL2L1-01        MSYNNRELVEHFLRYKLSQRNYPTSLLRPEDTDGRTEGEKRSPAASNGLL
                                        :*   :  :*  .**                 * 

A0A3B5KD08_BCL2L10      LCSTSQCPAPPPPSES----ATAMRHLGQDMEKQHQARFNSLAQTFLRQC
H2U5I3_BCL2L1-01        VRSRNRGGASPSAGAGIEAVNAALRDSAEEFEKLFAQAFSDLSSQL--DI
                        : * ..  *.*... .     :*:*  .:::** .   *..*:. :  : 

A0A3B5KD08_BCL2L10      GPDLC-SSLRKVMEELVGDGHLNWGRVVSLFTFTGVLARLMQEQKSTKPG
H2U5I3_BCL2L1-01        TPDTAYQSFKNVMDEVFKDG-VNWGRVVGLFAFGGVLCVECVEKDASQL-
                         ** . .*:.:**:*:. ** :******.**:* ***.    *:.:::  

A0A3B5KD08_BCL2L10      LDPGQEQQLGQVPENCRGLAETIADYLGEEKKDWLLENGGWEGFCK-YSL
H2U5I3_BCL2L1-01        --------------VCR-IADWMTIYLDEHINPWIQSQGGWDCFAKIFGD
                                       ** :*: :: **.*  : *: .:***: *.* :. 

A0A3B5KD08_BCL2L10      AAREVNHDSSMKTALFAAAGVG-----LAGLTFLLVR
H2U5I3_BCL2L1-01        DAAAEGRRARENLSRWMLGGLALLMGVLVGAFIVKKH
                         *   .. :  : : :  .*:.     *.*  ::  .

© 1998-2020Legal notice