Dataset for protein Bcl2l10 of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4X1T1Z2_BCL2L10      MADAFRERTARLLTDYLEYCAREPGTAARQPSSPEAAVLRCVAAQIREYN
F1RZB9_BCL2L10-01       MADAFRERTARLLTDYLEYCAREPGTAARQPSSPEAAVLRCVAAQIREYN
                        **************************************************

A0A4X1T1Z2_BCL2L10      VRTLSVYRGFRWNRVELVAWMAQKLLASPRGPNWYRVASLLTFAGMLLER
F1RZB9_BCL2L10-01       VRTLSVYRGFRWNRVELVAWMAQKLLASPRGPNWYRVASLLTFAGMLLER
                        **************************************************

A0A4X1T1Z2_BCL2L10      HPR------------SRDCRLLVALLCAQLSGQHRTWLLANGGWDGFCLF
F1RZB9_BCL2L10-01       HPREACGRKKKEGNVSRDCRLLVALLCAQLSGQHRTWLLANGGWDGFCLF
                        ***            ***********************************

A0A4X1T1Z2_BCL2L10      FQGSLQQTWTRHMVWVFVSYCTAVVLLYLWRKLL
F1RZB9_BCL2L10-01       FQGSLQQTWTRHMVWVFVSYCTAVVLLYLWRKLL
                        **********************************

© 1998-2020Legal notice