Dataset for protein Bcl-xL of organism Sparus aurata

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0B4KJI5_BCL2L1-      MSYSNRELVESFLSYKLSQRNYPTALLRPDDAGGRTEADKANSAATNGLL
A0A671WXV0_BCL2L1-      -MSQNRELVVFYINYKLSQRNYPLNHMGLIESPNRTDGGATH--------
                           .*****  ::.*********   :   :: .**:.. ::        

A0A0B4KJI5_BCL2L1-      ANSSNGGGQPG---------------ADIEAVKAALRDSSEEFELLFTQA
A0A671WXV0_BCL2L1-      ANGTFNGMSPGTPPASPLRQQRLPSTTSLDAVKEALRDSANEFELRYARA
                        **.: .* .**               :.::*** *****::**** ::.*

A0A0B4KJI5_BCL2L1-      FSDLSTQLDITPDTAYHSFKSVMDEVFKDGVNWGRVVGLFAFGGVLCVEC
A0A671WXV0_BCL2L1-      FSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVEC
                        **** .** *** ***:**:.******.****************.*****

A0A0B4KJI5_BCL2L1-      VEKDTSELVSRIADWMTMYLDEHINPWIESQGGWDSFAEVFGRDAAAEAR
A0A671WXV0_BCL2L1-      MEKEMSPLVGRIIEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAESR
                        :**: * **.** :***:***:**:***:*****: ***:**.*****:*

A0A0B4KJI5_BCL2L1-      RSRETLSRWLLVGVALLMGVVLGVLIAKKQ-
A0A671WXV0_BCL2L1-      RSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
                        **.*::..***.*::*: ***:* ***:*. 

© 1998-2020Legal notice