Dataset for protein Bcl-xL of organism Scophthalmus maximus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2U9BY16_BCL2L1-      -MSQNKELVVFYIQYKLSQRKY-----------PLNHMGLNEPP------
A0A2U9BY16_BCL2L1-      -MSQNKELVVFYIQYKLSQRKY-----------PLNHMGLNEPP------
A0A2U9BY16_BCL2L1-      -MSQNKELVVFYIQYKLSQRKY-----------PLNHMGLNEPP------
A0A2U9BY16_BCL2L1-      -MSQNKELVVFYIQYKLSQRKY-----------PLNHMGLNEPP------
A0A2U9BIG9_BCL2L1-      MSDSNRELVEFFIGYKLSQRNY-----------PTSLL-RPEDAGGRTEG
A0A2U9BY16_BCL2L1-      ------DARQRFCGEHHSRPEWIRQLFCRFGFHPQSLLWISADHGCLNRG
                              :    :   : *. ::           * . :            

A0A2U9BY16_BCL2L1-      -------------NRTDRGEAGLGEEQQTAPHANGTLNGVNPGTPPESPL
A0A2U9BY16_BCL2L1-      -------------NRTDRGEAGLGEEQQTAPHANGTLNGVNPGTPPESPL
A0A2U9BY16_BCL2L1-      -------------NRTDRGEAGLGEEQQTAPHANGTLNGVNPGTPPESPL
A0A2U9BY16_BCL2L1-      -------------NRTDRGEAGLGEEQQTAPHANGTLNGVNPGTPPESPL
A0A2U9BIG9_BCL2L1-      DKANSAASNGLLVDGGNRC----------------------------GQL
A0A2U9BY16_BCL2L1-      KQGDSLAQRAFTLTQTDRGEAGLGEEQQTAPHANGTLNGVNPGTPPESPL
                                        :*                             . *

A0A2U9BY16_BCL2L1-      RLQRLPSSPSLDAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQS
A0A2U9BY16_BCL2L1-      RLQRLPSSPSLDAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQS
A0A2U9BY16_BCL2L1-      RLQRLPSSPSLDAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQS
A0A2U9BY16_BCL2L1-      RLQRLPSSPSLDAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQS
A0A2U9BIG9_BCL2L1-      GTDPLPPDGGVGAVKEALRDSAHEFEQLFNQAFSDLSLQLDITPDTAYQS
A0A2U9BY16_BCL2L1-      RLQRLPSSPSLDAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQS
                          : **.. .:.**********:***  : .*****  ** *** *****

A0A2U9BY16_BCL2L1-      FESVMNEVFRDGVNWGRIIGLFAFGGALSVECVEKEMSSLVGRIVEWMTV
A0A2U9BY16_BCL2L1-      FESVMNEVFRDGVNWGRIIGLFAFGGALSVECVEKEMSSLVGRIVEWMTV
A0A2U9BY16_BCL2L1-      FESVMNEVFRDGVNWGRIIGLFAFGGALSVECVEKEMSSLVGRIVEWMTV
A0A2U9BY16_BCL2L1-      FESVMNEVFRDGVNWGRIIGLFAFGGALSVECVEKEMSSLVGRIVEWMTV
A0A2U9BIG9_BCL2L1-      FKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECVEKNRGELVARIADWMTM
A0A2U9BY16_BCL2L1-      FESVMNEVFRDGVNWGRIIGLFAFGGALSVECVEKEMSSLVGRIVEWMTV
                        *:***:***.********:*******.*.******: ..**.**.:***:

A0A2U9BY16_BCL2L1-      YLDNNIQPWIQSQGGWTFCHQTTRPVKPRKMKMPPRTVFHSADGSCISGK
A0A2U9BY16_BCL2L1-      YLDNNIQPWIQSQGGWEHFAE-----------------IFGQDAAAGSRR
A0A2U9BY16_BCL2L1-      YLDNNIQPWIQSQGGWEHFAE-----------------IFGQDAAAGSRR
A0A2U9BY16_BCL2L1-      YLDNNIQPWIQSQGGWEHFAE-----------------IFGQDAAAGSRR
A0A2U9BIG9_BCL2L1-      YLDEHISPWIQSQGGWGCFAE-----------------IFGQGAGAEARR
A0A2U9BY16_BCL2L1-      YLDNNIQPWIQSQGGWEHFAE-----------------IFGQDAAAGSRR
                        ***::*.*********    :                 :.. .... : .

A0A2U9BY16_BCL2L1-      VWQNLSRYTAAGQRGEKQEGVQCHGCNRLTHPPPLSVVCVVAGSLSLIFS
A0A2U9BY16_BCL2L1-      SQESFKKWLLAG-------------------------MTLVTGVVVGSLI
A0A2U9BY16_BCL2L1-      SQESFKKWLLAG-------------------------MTLVTGVVVGSLI
A0A2U9BY16_BCL2L1-      SQESFKKWLLAG-------------------------MTLVTGVVVGSLI
A0A2U9BIG9_BCL2L1-      YRESVRRWLLVG-------------------------VGMLTGVLIAMFI
A0A2U9BY16_BCL2L1-      SQESFKKWLLAG-------------------------MTLVTGVVVGSLI
                         .:.. .:  .*                         : :::* :   : 

A0A2U9BY16_BCL2L1-      TARGI
A0A2U9BY16_BCL2L1-      AQKRL
A0A2U9BY16_BCL2L1-      AQKRL
A0A2U9BY16_BCL2L1-      AQKRL
A0A2U9BIG9_BCL2L1-      AKKQ-
A0A2U9BY16_BCL2L1-      AQKRL
                        : .  

© 1998-2020Legal notice