Dataset for protein Bcl-xL of organism Salmo salar

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


C0HAD8_BCL2L1-01        -MSYSNRELVVFFISYRLSQRNYSCCQLGLEGASGRTEGD----------
A0A1S3MED7_BCL2L1-      -MTYNNRELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGQAEGGAAVTT
B5XAY3_BCL2L1-01        MMTYNNRELVVYYITYKLSQRDYPFNHMELTEAQNRTEVGQVEGGAAVLT
                         *:*.******::*:*.****:*.  :: *  * .*** .          

C0HAD8_BCL2L1-01        --DAIANGSVGNSRSNLAKPSSPQG--GMEPVKAALRDSVDEFELRYTRA
A0A1S3MED7_BCL2L1-      HPNGAANGTSPGTPPRQSPPSSPQRTMGLDAVKEALRDSANEFELRYARA
B5XAY3_BCL2L1-01        YVNGTSPGTP---PPRQSPPSSPRRTAGLDAVKEALRDSANEFELRYARA
                          :. : *:     .. : ****.   *::.** *****.:******:**

C0HAD8_BCL2L1-01        FSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVEC
A0A1S3MED7_BCL2L1-      FSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVEC
B5XAY3_BCL2L1-01        FSDLSSQLHITPSTAYQSFENVMDEVFRDGVNWGRVVGLFSFGGALCVEC
                        ************:***:***.*******************:*********

C0HAD8_BCL2L1-01        VEKDMSPLVARIADWMTTYLDNHIQPWIQSQGGWDRFAEIFGRDAAADVR
A0A1S3MED7_BCL2L1-      VEKEMSPLVGRIADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAESR
B5XAY3_BCL2L1-01        VDKEMNPLVGRITDWMTVYLDNHIQPWIQSQGGWDRFAEIFGMDAAAESR
                        *:*:*.***.**:****.************************ ****: *

C0HAD8_BCL2L1-01        RSQESIIKWLLVGVILLSGVLVGTLIMKKRQ
A0A1S3MED7_BCL2L1-      KSQENFKKWLLAGMTLVTGVIVGSLIAQKRL
B5XAY3_BCL2L1-01        KSQESFKKWLLAGMTLVTGVVVGSLFAQKRL
                        .***.: ****.*: *::**:**:*: :** 

© 1998-2022Legal notice