Dataset for protein Mcl-1 of organism Pongo abelii

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H2N5Y9_MCL1-03      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLL------------------------
H2N5Y9_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGAVIGGS
H2N5Y9_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGAVIGGS
                    ************************************                        

H2N5Y9_MCL1-03      ------------------------------------------------------------
H2N5Y9_MCL1-01      AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLFFFAPTRRAAPLEEMEAPAADAIM
H2N5Y9_MCL1-02      AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLFFFAPTRRAAPLEEMEAPAADAIM
                                                                                

H2N5Y9_MCL1-03      ------------------------------------------------------------
H2N5Y9_MCL1-01      SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
H2N5Y9_MCL1-02      SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
                                                                                

H2N5Y9_MCL1-03      ---------ATGAKDTKPLGRSGATCRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
H2N5Y9_MCL1-01      IISRYLREQATGAKDTKPLGRSGATCRKALETLRRVGDGVQRNHETAFQGWVC-------
H2N5Y9_MCL1-02      IISRYLREQATGAKDTKPLGRSGATCRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
                             ***************************************** :        

H2N5Y9_MCL1-03      DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
H2N5Y9_MCL1-01      ------------------------------GVLPCRGPRR-RHQKCAAGFCRCCWS----
H2N5Y9_MCL1-02      DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
                                                  *.: ..  .  .::.*   :. .  .    

H2N5Y9_MCL1-03      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
H2N5Y9_MCL1-01      --RSWF---------------------------------GISNKIALL--
H2N5Y9_MCL1-02      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                      *.*:                                 *:.  :* *  

© 1998-2022Legal notice