Dataset for protein Mcl-1 of organism Physeter macrocephalus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2Y9S808_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGPGSDSGASPPGRRLLAAGKEATAGREVG
A0A2Y9S808_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGPGSDSGASPPGRRLL-------------
                        *************************************             

A0A2Y9S808_MCL1-01      GGEAGEVIGGSAGPSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFF
A0A2Y9S808_MCL1-02      --------------------------------------------------
                                                                          

A0A2Y9S808_MCL1-01      APTRRASPPEEMESSASDAIMSPEEELDGCEPEPLGKRPAVLPLLELVGE
A0A2Y9S808_MCL1-02      --------------------------------------------------
                                                                          

A0A2Y9S808_MCL1-01      ASNSPGKDGSLPSTPPPAEEEEDELYRQSLEIISRYLQEQATGTKDAKPL
A0A2Y9S808_MCL1-02      ----------------------------------------ATGTKDAKPL
                                                                **********

A0A2Y9S808_MCL1-01      GGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
A0A2Y9S808_MCL1-02      GGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
                        **************************************************

A0A2Y9S808_MCL1-01      MVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLV
A0A2Y9S808_MCL1-02      MVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLV
                        **************************************************

A0A2Y9S808_MCL1-01      RTKRDWLVKQRGWDGFVDFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2Y9S808_MCL1-02      RTKRDWLVKQRGWDGFVDFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
                        **************************************************

A0A2Y9S808_MCL1-01      R
A0A2Y9S808_MCL1-02      R
                        *

© 1998-2020Legal notice