Dataset for protein Bcl-2 of organism Pelodiscus sinensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


K7F5Y3_BCL2-01      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAANENRGPVSSSLSPPAAGTPSDHAGLVSL
K7F5Y3_BCL2-02      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAANENRGPVSSSLSPPAAGTPSDHAGLVSL
                    ************************************************************

K7F5Y3_BCL2-01      PPEPPGSAAASNVPLGDGLRSAPQAVHLTLCQAGDEFSRRYHRDFAQMSGQLHLTPFTAR
K7F5Y3_BCL2-02      PPEPPGSAAASNVPLGDGLRSAPQAVHLTLCQAGDEFSRRYHRDFAQMSGQLHLTPFTAR
                    ************************************************************

K7F5Y3_BCL2-01      GRFVAVVEELFRDGINWGRIVAFFEFGGVMCVESVNREMSPLVDSIAVWMTEYLNRHLHN
K7F5Y3_BCL2-02      GRFVAVVEELFRDGINWGRIVAFFEFGGVMCVESVNREMSPLVDSIAVWMTEYLNRHLHN
                    ************************************************************

K7F5Y3_BCL2-01      WIQDNGGWDAFVELYGSNMRPLFDFSWISLKTILSLALVGACITLGAYLGHK
K7F5Y3_BCL2-02      WIQDNGGWAGAVSVL-------------------------------------
                    ******** . *.:                                      

© 1998-2020Legal notice