Dataset for protein Bcl-xL of organism Oryzias sinensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C7XSQ2_BCL2L1-      MTKWKKS---WHLTYKMSCRDYPVSLLKPTDD-----GGETEEDHSTARN
A0A8C7XSQ2_BCL2L1-      MSHCNRELVRFYLAYKMSCRDYPVSLLKPTDD-----GGETEEDHSTARN
A0A8C7YJI1_BCL2L1-      -MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAGEVGEEHSTETH
                            :..   ::: **:* *:**:. :  .:.     .**. *:***  :

A0A8C7XSQ2_BCL2L1-      GR-------PVSSEDGQLR-RSCPCCASMDAIKSTLKDSADEFERRFHQG
A0A8C7XSQ2_BCL2L1-      GR-------PVSSEDGQLR-RSCPCCASMDAIKSTLKDSADEFERRFHQG
A0A8C7YJI1_BCL2L1-      ANGTFNGTTPGTPPLSPLREQQLPSTTNMDAVKEALRDTANEFELRYALA
                        ..       * :.  . ** .. *. :.***:*.:*.*:*:*** *:  .

A0A8C7XSQ2_BCL2L1-      FSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVEC
A0A8C7XSQ2_BCL2L1-      FSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVEC
A0A8C7YJI1_BCL2L1-      FNNLHSQLHITPATAYQSFENVMNELFRDNINWGRIVGLFAFGGALCVEC
                        *.:*  ****** ****.*:.*::***.*.*****:****.*********

A0A8C7XSQ2_BCL2L1-      VERNMGELVSRIAEWMTQYLDEQISPWIHSHGGWDCFARLYGQNGAAEAR
A0A8C7XSQ2_BCL2L1-      VERNMGELVSRIAEWMTQYLDEQISPWIHSHGGWDCFARLYGQNGAAEAR
A0A8C7YJI1_BCL2L1-      VEKEMSPLVDRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQEAAAESR
                        **.:*. **.**.**** ***::*.***:*:***: ** ::**:.***:*

A0A8C7XSQ2_BCL2L1-      RFQETLKKWMLVTVALLTGLLLGVLITKKR-
A0A8C7XSQ2_BCL2L1-      RFQETLKKWMLVTVALLTGLLLGVLITKKR-
A0A8C7YJI1_BCL2L1-      RSQESFKKWLLVGMTVATGVLVGSFLAQKRL
                        * **::***:** ::: **:*:* ::::** 

© 1998-2023Legal notice