Dataset for protein Bcl-xL of organism Oryzias javanicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A437DD16_BCL2L1-      MSHCNRELVQFYLGYKMSSRDYPVSLLKPTDDGGQT-------EEDRSAV
A0A437D660_BCL2L1-      -MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAEEVGEEQSTETH
A0A437D660_BCL2L1-      -MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAEEVGEEQSTETH
                            ***** **: **:*.*:**:. :  .:. ..*       *:. .: 

A0A437DD16_BCL2L1-      CNGTLVNSEDD-------QLKKSCPCCNSMDAIKSTLKDSADEFERRFYQ
A0A437D660_BCL2L1-      ANGTFNGTSPGTPPLSPLRQQQLPPSTTNMDAVKEALRDTANEFELRYAL
A0A437D660_BCL2L1-      ANGTFNGTSPGTPPLSPLRQQQLPPSTTNMDAVKEALRDTANEFELRYAL
                        .***: .:. .       . ::  *. ..***:*.:*.*:*:*** *:  

A0A437DD16_BCL2L1-      GFSDLSVQLHITPDTAYQNFKSVLDELFKDGINWGRVVGLFVFGGVLCVE
A0A437D660_BCL2L1-      AFNNLHSQLHITPATAYQSFENVMNELFRDNINWGRIVGLFAFGGALCVE
A0A437D660_BCL2L1-      AFNNLHSQLHITPATAYQSFENVMNELFRDNINWGRIVGLFAFGGALCVE
                        .*.:*  ****** ****.*:.*::***.*.*****:****.***.****

A0A437DD16_BCL2L1-      CVERNMSELVSRIAEWMTMYLDEQISPWIHSQGGW---------------
A0A437D660_BCL2L1-      CVEKEMSPLVDRIVEWMTVYLDNHIQPWIQSQGGW---------------
A0A437D660_BCL2L1-      CVEKEMSPLVDRIVEWMTVYLDNHIQPWIQSQGGWLLPEHQLLMRDIKPA
                        ***.:** **.**.****:***::*.***:*****               

A0A437DD16_BCL2L1-      -------DCFARLYGQDGAAEARRFQETLKKWTLVAVALLTGLLLGLLIA
A0A437D660_BCL2L1-      -------ERFAEIFGQEAAAESRRSQESFKKWLLVGMTVATGVLVGSFIA
A0A437D660_BCL2L1-      APQRHTHERFAEIFGQEAAAESRRSQESFKKWLLVGMTVATGVLVGSFIA
                               : ** ::**:.***:** **::*** **.::: **:*:* :**

A0A437DD16_BCL2L1-      KK--
A0A437D660_BCL2L1-      QKRL
A0A437D660_BCL2L1-      QKRL
                        :*  

© 1998-2020Legal notice