Dataset for protein Bcl-2 of organism Oryzias javanicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3S2PV78_BCL2-04      MSSKEGFSSAVTDWLFINSWWILLPFIMLLIVVAFIVAFVLLLYMISPLI
A0A3S2PV78_BCL2-01      ------------------------------------MANVSHRSIVEKYI
A0A3S2PV78_BCL2-02      ---------------------------MLLIVVAFIVAFVLLLYMISPLI
A0A3S2PV78_BCL2-03      MSSKEGFSSAVTDWLFINSWWILLPFIMLLIVVAFIVAFVLLLYMISPLI
                                                            :* *    ::.  *

A0A3S2PV78_BCL2-04      SPKPLK------LNGAHVVVTGGSGGIGKSIAIECFRQGAFITLVARDE-
A0A3S2PV78_BCL2-01      CHKLSKRGYVFGLDGGQHEDAANNGSLGDRSPTPVRRRCDAGT--GPDGE
A0A3S2PV78_BCL2-02      SPKPLK------LNGAHVVVTGGSGGIGKSIAIECFRQGAFITLVARDED
A0A3S2PV78_BCL2-03      SPKPLK------LNGAHVVVTGGSGGIGKSIAIECFRQGAFITLVARDED
                        . *  *      *:*.:   :...*.:*.  .    *.    *  . *  

A0A3S2PV78_BCL2-04      ------------------VVLCVSVDISSDYTQVENVIKQAQEKLGPVDM
A0A3S2PV78_BCL2-01      RSPRLIRALEP-------------------HADIHRVLREAGDEL-----
A0A3S2PV78_BCL2-02      KLLKAKKEVEKFAINDKQVVLCVSVDISSDYTQVENVIKQAQEKLGPVDM
A0A3S2PV78_BCL2-03      KLLKAKKEVEKFAINDKQVVLCVSVDISSDYTQVENVIKQAQEKLGPVDM
                                                      :::: .*:.:* ::*     

A0A3S2PV78_BCL2-04      LVNCAGTAVAGKFEEMEVERFK----------------------------
A0A3S2PV78_BCL2-01      -------------ERLYQRDFTEMSRQLYLTSTTAKTRFAEVIDELFRDG
A0A3S2PV78_BCL2-02      LVNCAGTAVAGKFEEMEVERFKELMEVNYLGSVYPTRAVITTMKER----
A0A3S2PV78_BCL2-03      LVNCAGTAVAGKFEEMEVERFKELMEVNYLGSVYPTRAVITTMKER----
                                     * :    *.                            

A0A3S2PV78_BCL2-04      --------------------------------------------------
A0A3S2PV78_BCL2-01      VNWGRIIAF---------FEFGG----------------TVCVECASDEE
A0A3S2PV78_BCL2-02      -RMGRIVFVSSQ------FALRGLAESLQMEMKPYNIYVTVAFPPDTDTP
A0A3S2PV78_BCL2-03      -RMGRIVFVSSQAGQIGLFGYTAYSPSSLLCMKPYNIYVTVAFPPDTDTP
                                                                          

A0A3S2PV78_BCL2-04      --------------------------------------------------
A0A3S2PV78_BCL2-01      MSAQVASIAEWMTEYLNGPLNSWIED-----------NGGWD--------
A0A3S2PV78_BCL2-02      LLAEENKSKPLETKLISETSGVWQPDQVAKVFVKDAVQGNFNSSVGPDGY
A0A3S2PV78_BCL2-03      LLAEENKSKPLETKLISETSGVWQPDQVAKVFVKDAVQGNFNSSVGPDGY
                                                                          

A0A3S2PV78_BCL2-04      ---------------------IVTMGLF----------------RTIALF
A0A3S2PV78_BCL2-01      ----------------------AFVELYDRQKETVFSCYWPSIKTVFGLA
A0A3S2PV78_BCL2-02      MLSALTCGMSPVTSITEGLQQDAFVELYDRQKETVFSCYWPSIKTVFGLA
A0A3S2PV78_BCL2-03      MLSALTCGMSPVTSITEGLQQIVTMGLF----------------RTIALF
                                              . : *:                 .:.* 

A0A3S2PV78_BCL2-04      YLGSFDSIVRRCMIQREQSKTANKTE
A0A3S2PV78_BCL2-01      ALGAASLTIGAYLAQK----------
A0A3S2PV78_BCL2-02      ALGAASLTIGAYLAQK----------
A0A3S2PV78_BCL2-03      YLGSFDSIVRRCMIQREQSKTANKTE
                         **: .  :   : *.          

© 1998-2020Legal notice