Dataset for protein Bcl-2 of organism Oryzias javanicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3S2PV78_BCL2-01      ------------------------------------MANVSHRSIVEKYI
A0A3S2PV78_BCL2-04      MSSKEGFSSAVTDWLFINSWWILLPFIMLLIVVAFIVAFVLLLYMISPLI
A0A3S2PV78_BCL2-03      MSSKEGFSSAVTDWLFINSWWILLPFIMLLIVVAFIVAFVLLLYMISPLI
A0A3S2PV78_BCL2-02      ---------------------------MLLIVVAFIVAFVLLLYMISPLI
                                                            :* *    ::.  *

A0A3S2PV78_BCL2-01      CHKLSKRGYVFGLDGGQHEDAANNGSLGDRSPTPVRRRCDAGTGPDGERS
A0A3S2PV78_BCL2-04      SPKPLK------LNGAHVVVTGGSGGIGKSIAIECFRQGAFITLVARDE-
A0A3S2PV78_BCL2-03      SPKPLK------LNGAHVVVTGGSGGIGKSIAIECFRQGAFITLVARDED
A0A3S2PV78_BCL2-02      SPKPLK------LNGAHVVVTGGSGGIGKSIAIECFRQGAFITLVARDED
                        . *  *      *:*.:   :...*.:*.  .    *.    *    :  

A0A3S2PV78_BCL2-01      PRL---------------------IRALEPHADIHRVLREAGDELERLYQ
A0A3S2PV78_BCL2-04      ------------------VVLCVSVDISSDYTQVENVIKQAQEKLG----
A0A3S2PV78_BCL2-03      KLLKAKKEVEKFAINDKQVVLCVSVDISSDYTQVENVIKQAQEKLG----
A0A3S2PV78_BCL2-02      KLLKAKKEVEKFAINDKQVVLCVSVDISSDYTQVENVIKQAQEKLG----
                                                :   . :::: .*:.:* ::*     

A0A3S2PV78_BCL2-01      RDFTEMSRQLYLTSTTAKTRFAEVIDELFRDGVNWGRIIAFFEFGG----
A0A3S2PV78_BCL2-04      ----PVDMLVNCAGTAVAGKFEEMEVERFK--------------------
A0A3S2PV78_BCL2-03      ----PVDMLVNCAGTAVAGKFEEMEVERFKELMEVNYLGSVYPTRAVITT
A0A3S2PV78_BCL2-02      ----PVDMLVNCAGTAVAGKFEEMEVERFKELMEVNYLGSVYPTRAVITT
                             :.  :  :.*:.  .* *:  * *.                    

A0A3S2PV78_BCL2-01      ------------------------------------------TVCVECAS
A0A3S2PV78_BCL2-04      --------------------------------------------------
A0A3S2PV78_BCL2-03      MKERRMGRIVFVSSQAGQIGLFGYTAYSPSSLLCMKPYNIYVTVAFPPDT
A0A3S2PV78_BCL2-02      MKERRMGRIVFVSSQ------FALRGLAESLQMEMKPYNIYVTVAFPPDT
                                                                          

A0A3S2PV78_BCL2-01      DEEMSAQVASIAEWMTEYLNGPLNSWIEDNGGW-----------------
A0A3S2PV78_BCL2-04      --------------------------------------------------
A0A3S2PV78_BCL2-03      DTPLLAEENKSKPLETKLISETSGVWQPDQVAKVFVKDAVQGNFNSSVGP
A0A3S2PV78_BCL2-02      DTPLLAEENKSKPLETKLISETSGVWQPDQVAKVFVKDAVQGNFNSSVGP
                                                                          

A0A3S2PV78_BCL2-01      ------------------------DAFVELYDRQKETVFSCYWPSIKTVF
A0A3S2PV78_BCL2-04      ------------------------IVTMGLF----------------RTI
A0A3S2PV78_BCL2-03      DGYMLSALTCGMSPVTSITEGLQQIVTMGLF----------------RTI
A0A3S2PV78_BCL2-02      DGYMLSALTCGMSPVTSITEGLQQDAFVELYDRQKETVFSCYWPSIKTVF
                                                 . : *:                 .:

A0A3S2PV78_BCL2-01      GLAALGAASLTIGAYLAQK----------
A0A3S2PV78_BCL2-04      ALFYLGSFDSIVRRCMIQREQSKTANKTE
A0A3S2PV78_BCL2-03      ALFYLGSFDSIVRRCMIQREQSKTANKTE
A0A3S2PV78_BCL2-02      GLAALGAASLTIGAYLAQK----------
                        .*  **: .  :   : *.          

© 1998-2021Legal notice