Dataset for protein Bcl-2 of organism Oncorhynchus mykiss

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C7Q7B4_BCL2-01      -MANDNPYNSRFIVEKYIHHKLLKKGFVWEFYPENDSPNNGFGEPSPPNS
A0A8C7RG50_BCL2-01      MMANENPYNSRFIVEKYIHHKLLKMGFVWKFQGENDSPNNGFGDPSTPNS
                         ***:******************* ****:*  **********:**.***

A0A8C7Q7B4_BCL2-01      PEVFARRSQPSAEGVDTDSPLQNRIPQPDRHARLHRVLREAGDEIEIMYQ
A0A8C7RG50_BCL2-01      PEVFARRSQPTAAGEDTDSPYQNRSPQPDPHARLHRVLRDAGGEIERMYQ
                        **********:* * ***** *** **** *********:**.*** ***

A0A8C7Q7B4_BCL2-01      RDFAEMSGQLHFTPSTAQRRFTAVIEELFSDGINWGRIVAFFEFGGTMCV
A0A8C7RG50_BCL2-01      RDFAEMSGQLHFTPSTAQRRFTAVIDELFSDGVNWGRIVAFFEFGGTMCV
                        *************************:******:*****************

A0A8C7Q7B4_BCL2-01      ESVNREMTSQVDNIAHWMTEYLNGPLQNWIQENGDWDAFVEIYGQQRISA
A0A8C7RG50_BCL2-01      ESVNREMTSQVDNIARWMTEYLNGPLQNWIQENGGWDAFVEIYEQQRIS-
                        ***************.******************.******** ***** 

A0A8C7Q7B4_BCL2-01      FHSWPYLKTVFGLAALGAAGVTIGALFIQK
A0A8C7RG50_BCL2-01      -HSWPYLKTVFGLAALGAAGVTIGALFTQK
                         ************************** **

© 1998-2023Legal notice