Dataset for protein Mcl-1 of organism Naja naja

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6VLE3_MCL1-02      RHRAGAFITGAPGARHSPPQNQAVLEAGRHVQQEDDGSVLRRLPGLAPAA
A0A8C6VLE3_MCL1-01      RHRAGAFITGAPGARHSPPQNQAVLEAGRHVQQEDDGSVLRRLPGLAPAA
                        **************************************************

A0A8C6VLE3_MCL1-02      PQSPGGGGGGSGEGGLALLPGGVRGGLGGGLCWPPAGCAEGPRALIGGGP
A0A8C6VLE3_MCL1-01      PQSPGGGGGGSGEGGLALLPGGVRGGLGGGLCWPPAGCAEGPRALIGGGP
                        **************************************************

A0A8C6VLE3_MCL1-02      RAGPLSLIGTRDAAARALIGQASAATTPEEELDGCEPEAETGAESSAASS
A0A8C6VLE3_MCL1-01      RAGPLSLIGTRDAAARALIGQASAATTPEEELDGCEPEAETGAESSAASS
                        **************************************************

A0A8C6VLE3_MCL1-02      SSSSPAPPGEAGDPLRQVTLQLVASYLREAADQEPPKQDDCGGGGKFLQG
A0A8C6VLE3_MCL1-01      SSSSPAPPGEAGDPLRQVTLQLVASYLREAADQEPPKQDDCGGGGKFLQG
                        **************************************************

A0A8C6VLE3_MCL1-02      LLGRFGPCPAEAETAARALETLRRVCDDIMEKHQLAFQGMLRKVQIDKAD
A0A8C6VLE3_MCL1-01      LLGRFGPCPAEAETAARALETLRRVCDDIMEKHQLAFQGMLRKVQIDKAD
                        **************************************************

A0A8C6VLE3_MCL1-02      DLKLMSEVATQVFNDGITNWGRIVTLISFGAFVAKHLKSINQESGISTLA
A0A8C6VLE3_MCL1-01      DLKLMSEVATQVFNDGITNWGRIVTLISFGAFVAKHLKSINQESGISTLA
                        **************************************************

A0A8C6VLE3_MCL1-02      EIITEVLVTEKREWLLHHNAWEGFVKF------FHVEDLEGSIRNILVAF
A0A8C6VLE3_MCL1-01      EIITEVLVTEKREWLLHHNAWTGSIKLQKRKGTFCMPEKKKTFKKKRKAS
                        ********************* * :*:      * : : : ::.:   * 

A0A8C6VLE3_MCL1-02      ASVAGLGASLAYLIR
A0A8C6VLE3_MCL1-01      GDDWDPPKS------
                        ..  .   *      

© 1998-2022Legal notice