Dataset for protein Bcl-xL of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


O35843_BCL2L1-01      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSA
Q64373_BCL2L1-09      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSA
Q64373_BCL2L1-01      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSA
                      **************************************************

O35843_BCL2L1-01      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q64373_BCL2L1-09      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q64373_BCL2L1-01      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
                      **************************************************

O35843_BCL2L1-01      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q64373_BCL2L1-09      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q64373_BCL2L1-01      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                      **************************************************

O35843_BCL2L1-01      CVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWGV----------
Q64373_BCL2L1-09      CVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAA
Q64373_BCL2L1-01      CVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAA
                      **************************************..          

O35843_BCL2L1-01      ----SGGTPLRSVFRRLVQVPGVAEHVCDPSLWEVETEGSEVQGPPQLL
Q64373_BCL2L1-09      AESRKGQERFNRWFLTGMTVAGV---VLLGSLFSRK-------------
Q64373_BCL2L1-01      AESRKGQERFNRWFLTGMTVAGV---VLLGSLFSRK-------------
                          .*   :.  *   : *.**   *   **:. :             

© 1998-2020Legal notice