Dataset for protein Bcl-w of organism Microcebus murinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B7FJ73_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAG--------PGEGPAADPL
A0A8B7FJ73_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAG--------PGEGPAADPL
A0A8B7FJ73_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL
A0A8B7FJ73_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL
                        **:.*:*. : . ...  .   *..  * ***         * *  .: *

A0A8B7FJ73_BCL2L2-      HQAMRAAGD----------EFETRFRRTFSDLAAQLHVTPGSAQQRFTQV
A0A8B7FJ73_BCL2L2-      HQAMRAAGD----------EFETRFRRTFSDLAAQLHVTPGSAQQRFTQV
A0A8B7FJ73_BCL2L2-      ESEELEPGD------------------------------------QEEEE
A0A8B7FJ73_BCL2L2-      ESEELEPGELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEE
                         .    .*:                                    .  : 

A0A8B7FJ73_BCL2L2-      SDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLET
A0A8B7FJ73_BCL2L2-      SDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLET
A0A8B7FJ73_BCL2L2-      EPGLVEGDPGDGAI------------------------------------
A0A8B7FJ73_BCL2L2-      EPGLVEGDPGDGAI------------------------------------
                        .  *.:*.*. * :                                    

A0A8B7FJ73_BCL2L2-      RLADWIHSSGGWA-EFTALYGDGALEEARRLRE---------------GN
A0A8B7FJ73_BCL2L2-      RLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGN
A0A8B7FJ73_BCL2L2-      ---------EDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGN
A0A8B7FJ73_BCL2L2-      ---------EDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGN
                                  .   *          *** .*.*               **

A0A8B7FJ73_BCL2L2-      WASV------------RTVLTGAVALGALVT-------------------
A0A8B7FJ73_BCL2L2-      AGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC
A0A8B7FJ73_BCL2L2-      AGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC
A0A8B7FJ73_BCL2L2-      AGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC
                         ..*            *:: .* *  ** .                    

A0A8B7FJ73_BCL2L2-      --------------------------------------------------
A0A8B7FJ73_BCL2L2-      DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGIS
A0A8B7FJ73_BCL2L2-      DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGIS
A0A8B7FJ73_BCL2L2-      DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGIS
                                                                          

A0A8B7FJ73_BCL2L2-      -------------------------------------------VGAFFAS
A0A8B7FJ73_BCL2L2-      TTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSP
A0A8B7FJ73_BCL2L2-      TTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSP
A0A8B7FJ73_BCL2L2-      TTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSP
                                                                   . ::::.

A0A8B7FJ73_BCL2L2-      K
A0A8B7FJ73_BCL2L2-      Y
A0A8B7FJ73_BCL2L2-      Y
A0A8B7FJ73_BCL2L2-      Y
                         

© 1998-2022Legal notice