Dataset for protein Bcl-xL of organism Marmota marmota marmota

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5YLY6_BCL2L1-      IESCGRTGRNLELVMDFLSYKLSQKGYRWSQFSREEENRVQAPERAESEE
A0A8C6ACA1_BCL2L1-      -----MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEV
A0A8C6ACA1_BCL2L1-      -----MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEV
                              :  * ***:************ *****  ****.:*** :*** 

A0A8C5YLY6_BCL2L1-      GPSNATSGNPSRHQGDSPMVSGAAGHNRSLDAPDVVPMVAVKQAMREAGD
A0A8C6ACA1_BCL2L1-      ETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGD
A0A8C6ACA1_BCL2L1-      ETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGD
                         ...* .****.* .*** *.**:**. **** :*:**.*****:*****

A0A8C5YLY6_BCL2L1-      NFEGRYRQAFHDLTAELRLTPETAHHTFEQVVDELFRDEVSWGRIVAFFF
A0A8C6ACA1_BCL2L1-      EFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFS
A0A8C6ACA1_BCL2L1-      EFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFS
                        :** ***.** ***::*.:** **:::*****:***** *.******** 

A0A8C5YLY6_BCL2L1-      FGGALCLESIDKEMKVLVCQIASWMTTYLNDHLDTWIQDHGGWDTF----
A0A8C6ACA1_BCL2L1-      FGGALCVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVELY
A0A8C6ACA1_BCL2L1-      FGGALCVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVELY
                        ******:**:****:***..*****:*******:.***::******    

A0A8C5YLY6_BCL2L1-      ------------------------------LACLI---
A0A8C6ACA1_BCL2L1-      GNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
A0A8C6ACA1_BCL2L1-      GNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
                                                      *..*:   

© 1998-2022Legal notice