Dataset for protein Mcl-1 of organism Mandrillus leucophaeus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5XSB2_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
A0A2K5XSB2_MCL1-03      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLL--------------
                        ************************************              

A0A2K5XSB2_MCL1-01      GEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTATPARLFFFA
A0A2K5XSB2_MCL1-03      --------------------------------------------------
                                                                          

A0A2K5XSB2_MCL1-01      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
A0A2K5XSB2_MCL1-03      --------------------------------------------------
                                                                          

A0A2K5XSB2_MCL1-01      GNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
A0A2K5XSB2_MCL1-03      ---------------------------------------ATGAKDTKPMG
                                                               ***********

A0A2K5XSB2_MCL1-01      RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A2K5XSB2_MCL1-03      RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
                        **************************************************

A0A2K5XSB2_MCL1-01      VHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
A0A2K5XSB2_MCL1-03      VHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
                        **************************************************

A0A2K5XSB2_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A2K5XSB2_MCL1-03      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                        **************************************************

© 1998-2020Legal notice