Dataset for protein Bcl-xL of organism Macaca fascicularis

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


I7GKS6_BCL2L1-01        --------------------------------------------------
A0A2K5VPG2_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
A0A2K5VPG2_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q2PFS6_BCL2L1-01        --------------------------------------------METPSA
                                                                          

I7GKS6_BCL2L1-01        -----MWKRTGLRPQKG-----------------------------LNRR
A0A2K5VPG2_BCL2L1-      INGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
A0A2K5VPG2_BCL2L1-      INGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q2PFS6_BCL2L1-01        INGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
                              *: ..  . :*                             :: *

I7GKS6_BCL2L1-01        WRPPVPSMATHPG-TPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
A0A2K5VPG2_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQ-------------------------
A0A2K5VPG2_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q2PFS6_BCL2L1-01        YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                        :* ....::::   ***********                         

I7GKS6_BCL2L1-01        CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
A0A2K5VPG2_BCL2L1-      --------------------------------------DTFVELYGNNAA
A0A2K5VPG2_BCL2L1-      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
Q2PFS6_BCL2L1-01        CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
                                                              ************

I7GKS6_BCL2L1-01        AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
A0A2K5VPG2_BCL2L1-      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
A0A2K5VPG2_BCL2L1-      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Q2PFS6_BCL2L1-01        AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
                        *********************************

© 1998-2022Legal notice