Dataset for protein Mcl-1 of organism Ictidomys tridecemlineatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A287DCH9_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGASGGATPPGAQLLAAEKEAAARREAGGG
A0A287DCH9_MCL1-02      MFGLKRNAVIGLNLYCG---------------------------------
                        *****************                                 

A0A287DCH9_MCL1-01      EAAQPPSARRVARPVPIGAEVPDVTATPARRLFFAPTYCVSPPEKMEAPA
A0A287DCH9_MCL1-02      -----------------GAEVPDVTATPARRLFFAPTYCVSPPEKMEAPA
                                         *********************************

A0A287DCH9_MCL1-01      AAMSPEEELDGYEPEPLGKRPAVLPLLELVGEAAKSPGADGSLPSTPPPA
A0A287DCH9_MCL1-02      AAMSPEEELDGYEPEPLGKRPAVLPLLELVGEAAKSPGADGSLPSTPPPA
                        **************************************************

A0A287DCH9_MCL1-01      EEEDDELYRQSLEIISRYLREQATGSKDAKPLRGSGAASRKALETLRRVG
A0A287DCH9_MCL1-02      EEEDDELYRQSLEIISRYLREQATGSKDAKPLRGSGAASRKALETLRRVG
                        **************************************************

A0A287DCH9_MCL1-01      DGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTL
A0A287DCH9_MCL1-02      DGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTL
                        **************************************************

A0A287DCH9_MCL1-01      ISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVE
A0A287DCH9_MCL1-02      ISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVE
                        **************************************************

A0A287DCH9_MCL1-01      FFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A287DCH9_MCL1-02      FFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                        *********************************

© 1998-2020Legal notice