Dataset for protein Bcl-w of organism Ictidomys tridecemlineatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A287D9B3_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
A0A287D9B3_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
                        **************************************************

A0A287D9B3_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
A0A287D9B3_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
                        **************************************************

A0A287D9B3_BCL2L2-      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTAL
A0A287D9B3_BCL2L2-      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW-----L
                        ********************************************     *

A0A287D9B3_BCL2L2-      YGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
A0A287D9B3_BCL2L2-      FSRGNMGALI----GGWDSC----AGKEAWG------------
                        :. * :        *.* *     :*  * *            

© 1998-2022Legal notice