Dataset for protein Bcl-2 of organism Heterocephalus glaber

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G5BGZ7_BCL2-02      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDGSAAPPGAAPTPGIFSSQPGRNSPPA
G5BGZ7_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDGSAAPPGAAPTPGIFSSQPGRNSPPA
                    ************************************************************

G5BGZ7_BCL2-02      APRDLAARTSPPPPLAGLAAAAGPVLSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
G5BGZ7_BCL2-01      APRDLAARTSPPPPLAGLAAAAGPVLSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
                    ************************************************************

G5BGZ7_BCL2-02      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
G5BGZ7_BCL2-01      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
                    ************************************************************

G5BGZ7_BCL2-02      LNRHLHTWIQDNGGW---VGLRQPT------------DTMASLMCVGLWVKLGA-----
G5BGZ7_BCL2-01      LNRHLHTWIQDNGGWDAFVELYGPSVRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
                    ***************   * *  *:            .*: **  **  :.***     

© 1998-2020Legal notice