Dataset for protein BCL-2-like of organism Gopherus agassizii

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A452I9V7_BCL2-01      MYLTACVCTLHWREKHSTSARAWSQRGYDNREIVLKYIHYKLSQRGYDWA
A0A452J3N6_BCL2A1-      -MESSEYCYVYY--------------------LVQDYLKYVLQE------
                           ::  * :::                    :* .*::* *.:      

A0A452I9V7_BCL2-01      ANENRGPVSPNLSPPTVTGTSSDHAGLMSLPPEPPGSAAASNVPLGDGLR
A0A452J3N6_BCL2A1-      ----------------------------------------------PQLG
                                                                        * 

A0A452I9V7_BCL2-01      PAPQAVLLALCQAGDEFSRRYHRDFAQMSGQLHLTPFTARGR-FVAVVEE
A0A452J3N6_BCL2A1-      PAPSRVAHVLRHAASFLQKENEESLKPCLDTFDITSVDAARRIFTQVMDK
                        ***. *  .* :*.. :..    .:    . : :*.. *  * *. *:::

A0A452I9V7_BCL2-01      LFRDG-VNWGRIVAFFEFGGVMCVESVNREMSPLVDS---IAVWMTEYLN
A0A452J3N6_BCL2A1-      EFADGNTNWGRILTIFMFGGILSKKLQEHRVQLTGENKKQISYFITEYII
                         * ** .*****:::* ***::. :  :. :.   :.   *: ::***: 

A0A452I9V7_BCL2-01      RHLHNWIQDNGGW-----------------------VCVQYFFLFKLQ
A0A452J3N6_BCL2A1-      NTKAEWIEANGGWENGFLTMFEEKRSWLSLFNIKAKIMDAFSFFSQYY
                        .   :**: ****                       :   : *: :  

© 1998-2022Legal notice