Dataset for protein Bcl-xL of organism Gadus morhua

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5FC81_BCL2L1-      MAQLDPARPLVSQNRELVLFYITHKLAQKNFPLNHLTLAATPPNRTEVGG
A0A8C5B4N8_BCL2L1-      ---MSIDTSMSISNRELVFFFLSHKLSQRNYRPIPFQPEGADEGTDEDKS
D2ITA2_BCL2L1-02        ---MSIDTSMSISNRELVFFFLSHKLSQRNYRPIPFQPEGAGEGTDEDKS
                           :.   .:  .*****:*:::***:*.*:    :   .:  .  *  .

A0A8C5FC81_BCL2L1-      AAPGPARVPAPHANGTPNGTTTAAAATPPPSPPPTAPPPRRQSSAETVAM
A0A8C5B4N8_BCL2L1-      NRIGNNGLRLNDGNGN-------GQLAPSPTPQGT---------------
D2ITA2_BCL2L1-02        NRIGNNGLRLNDGNGN-------GQLAPSPTPQGT---------------
                           *   :    .**.       .  :*.*:*  *               

A0A8C5FC81_BCL2L1-      AAVKEALRDTAGEFELRFTRAFSDLSSQLHITPATAYQSFESVMDEVFRD
A0A8C5B4N8_BCL2L1-      EAVRAALLESVEEFELRYTLAFSDLSSQLPITPATAYGSFESVMDEVFRD
D2ITA2_BCL2L1-02        EAVRAALLESVEEFELRYTLAFSDLSSQLPITPATAYGSFESVMDEVFRD
                         **. ** ::. *****:* ********* ******* ************

A0A8C5FC81_BCL2L1-      GVNWGRVVGLFAFGGALCVECVEKEMSSLVGRIAEWMTVYLDVHIQPWIQ
A0A8C5B4N8_BCL2L1-      SINWGRIVGLFAFGGALCVECVEKEMSHMVPRVAEWMTRYLDDHIDHWIQ
D2ITA2_BCL2L1-02        SINWGRIVGLFAFGGALCVECVEKEMSHMVPRVAEWMTRYLDDHIDHWIQ
                        .:****:******************** :* *:***** *** **: ***

A0A8C5FC81_BCL2L1-      AQGGWERFSEVFGKDAAAESRRSQESFRKWFLAGMTLFTGVVVGSLFAQK
A0A8C5B4N8_BCL2L1-      SNGGWKHFAAVFGSDAAAGARRTRDSHRRWMLVGAVLLTGVLLGALLAKK
D2ITA2_BCL2L1-02        SNGGWKHFAAVFGSDAAAGARRTRDSHRRWMLVGAALLTGVLLGALLAKK
                        ::***:.*: ***.**** :**:.:*.*.*:*.* .*:***::*:*:*:*

A0A8C5FC81_BCL2L1-      RL
A0A8C5B4N8_BCL2L1-      HV
D2ITA2_BCL2L1-02        HV
                        .:

© 1998-2022Legal notice