Dataset for protein Mcl-1 of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A337S3J9_MCL1-04      MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLV--------------
A0A337S3J9_MCL1-01      MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGG
A0A337S3J9_MCL1-03      MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGG
Q7YRZ9_MCL1-01          MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGG
                        ************************************              

A0A337S3J9_MCL1-04      --------------------------------------------------
A0A337S3J9_MCL1-01      GEAGAVIGGSAGASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFA
A0A337S3J9_MCL1-03      GEAGAVIGGSAGASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFA
Q7YRZ9_MCL1-01          GEAGAVIGGSAGASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFA
                                                                          

A0A337S3J9_MCL1-04      --------------------------------------------------
A0A337S3J9_MCL1-01      ATRCASPPEKMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
A0A337S3J9_MCL1-03      ATRCASPPEKMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
Q7YRZ9_MCL1-01          ATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
                                                                          

A0A337S3J9_MCL1-04      ---------------------------------------ATGAKDAKPLG
A0A337S3J9_MCL1-01      SSGPGTDGSLPSTPPPAEEEEDELFRQSLEIISRYLREQATGAKDAKPLG
A0A337S3J9_MCL1-03      SSGPGTDGSLPSTPPPAEEEEDELFRQSLEIISRYLREQATGAKDAKPLG
Q7YRZ9_MCL1-01          SSGPGTDGSLPSTPPPAEEEEDELFRQSLEIISRYLREQATGAKDAKPLG
                                                               ***********

A0A337S3J9_MCL1-04      GSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNENDVKSLSRVM
A0A337S3J9_MCL1-01      GSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNENDVKSLSRVM
A0A337S3J9_MCL1-03      GSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNENDVKSLSRVM
Q7YRZ9_MCL1-01          GSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNENDVKSLSRVM
                        **************************************************

A0A337S3J9_MCL1-04      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A337S3J9_MCL1-01      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A337S3J9_MCL1-03      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
Q7YRZ9_MCL1-01          VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
                        **************************************************

A0A337S3J9_MCL1-04      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A337S3J9_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGDKA--------------------
A0A337S3J9_MCL1-03      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Q7YRZ9_MCL1-01          TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                        *************************** .                     

© 1998-2020Legal notice