Dataset for protein Mcl-1 of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A337S3J9_MCL1-04      MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLV--------------
A0A337S3J9_MCL1-03      MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGG
Q7YRZ9_MCL1-01          MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGG
A0A337S3J9_MCL1-02      MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGG
A0A337S3J9_MCL1-01      MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGG
                        ************************************              

A0A337S3J9_MCL1-04      --------------------------------------------------
A0A337S3J9_MCL1-03      GEAGAVIGGSAGASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFA
Q7YRZ9_MCL1-01          GEAGAVIGGSAGASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFA
A0A337S3J9_MCL1-02      GEAGAVIGGSAGASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFA
A0A337S3J9_MCL1-01      GEAGAVIGGSAGASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFA
                                                                          

A0A337S3J9_MCL1-04      --------------------------------------------------
A0A337S3J9_MCL1-03      ATRCASPPEKMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
Q7YRZ9_MCL1-01          ATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
A0A337S3J9_MCL1-02      ATRCASPPEKMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
A0A337S3J9_MCL1-01      ATRCASPPEKMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
                                                                          

A0A337S3J9_MCL1-04      ---------------------------------------ATGAKDAKPLG
A0A337S3J9_MCL1-03      SSGPGTDGSLPSTPPPAEEEEDELFRQSLEIISRYLREQATGAKDAKPLG
Q7YRZ9_MCL1-01          SSGPGTDGSLPSTPPPAEEEEDELFRQSLEIISRYLREQATGAKDAKPLG
A0A337S3J9_MCL1-02      SSGPGTDGSLPSTPPPAEEEEDELFRQSLEIISRYLREQATGAKDAKPLG
A0A337S3J9_MCL1-01      SSGPGTDGSLPSTPPPAEEEEDELFRQSLEIISRYLREQATGAKDAKPLG
                                                               ***********

A0A337S3J9_MCL1-04      GSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNENDVKSLSRVM
A0A337S3J9_MCL1-03      GSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNENDVKSLSRVM
Q7YRZ9_MCL1-01          GSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNENDVKSLSRVM
A0A337S3J9_MCL1-02      GSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNENDVKSLSRVM
A0A337S3J9_MCL1-01      GSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNENDVKSLSRVM
                        **************************************************

A0A337S3J9_MCL1-04      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A337S3J9_MCL1-03      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
Q7YRZ9_MCL1-01          VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A337S3J9_MCL1-02      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A337S3J9_MCL1-01      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
                        **************************************************

A0A337S3J9_MCL1-04      TKRDWLVKQRGW-DGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A337S3J9_MCL1-03      TKRDWLVKQRGW-DGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
Q7YRZ9_MCL1-01          TKRDWLVKQRGW-DGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A337S3J9_MCL1-02      TKRDWLVKQRGWGKEAPTSLCLAHLLCSEQV-------------------
A0A337S3J9_MCL1-01      TKRDWLVKQRGW-DGFVEFFHVEDLEGGDKA-------------------
                        ************ .     : :  *  . .                    

A0A337S3J9_MCL1-04      R
A0A337S3J9_MCL1-03      R
Q7YRZ9_MCL1-01          R
A0A337S3J9_MCL1-02      -
A0A337S3J9_MCL1-01      -
                         

© 1998-2022Legal notice