Dataset for protein Bcl-xL of organism Esox lucius

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8XYL5_BCL2L1-      IMTYNNKELVAYYITYKLSQRNYPINHTGLTGAFDRTEGGEVEEVAAVTM
A0A3P8XFS0_BCL2L1-      -MSYSNRELVVFFINYKLSQRNYSCCELELEGASGRTEGEEATANGSVGN
A0A3P8XFS0_BCL2L1-      -MSYSNRELVVFFINYKLSQRNYSCCELELEGASGRTEGEEATANGSVGN
                         *:*.*.***.::*.********.     * ** .**** *.   .:*  

A0A3P8XYL5_BCL2L1-      HPNGTMNGTSPGTPTQQSPPSSPRRTVGLDAVKEALRDSANEFELRYALA
A0A3P8XFS0_BCL2L1-      GRNSRRNLGKPSTPQG-----------CMEAVKAALRDSADEFELRYTRA
A0A3P8XFS0_BCL2L1-      GRNSRRNLGKPSTPQG-----------CMEAVKAALRDSADEFELRYTRA
                          *.  *  .*.**              ::*** ******:******: *

A0A3P8XYL5_BCL2L1-      FSDLSSQLHLTPATAYQSFASVMDEVFRDGVNWGRVVGLFAFGGALCVEC
A0A3P8XFS0_BCL2L1-      FSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVEC
A0A3P8XFS0_BCL2L1-      FSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVEC
                        *********:******:** ******************************

A0A3P8XYL5_BCL2L1-      VEKEMSPLVGRIADWMTVYLDNHIQPWIESQGGWDRFAEIFGKDAAANSR
A0A3P8XFS0_BCL2L1-      VEKDMSLLVARIADWMTTYLDEHIQPWIQIQGGWDRFADIFGRDAAADIR
A0A3P8XFS0_BCL2L1-      VEKDMSLLVARIADWMTTYLDEHIQPWIQIQGGWDRFADIFGRDAAADIR
                        ***:** **.*******.***:******: ********:***.****: *

A0A3P8XYL5_BCL2L1-      KSQESFKKWLLAGMTLVTGVVVGSLIAQKRL--
A0A3P8XFS0_BCL2L1-      RSQESLRKWLLFGVMLLSGVLVGTLLMKKRQ--
A0A3P8XFS0_BCL2L1-      RSQESLRKWLLFG-------------MENAQWT
                        .****:.**** *              ::    

© 1998-2021Legal notice