Dataset for protein Bcl-xL of organism Erpetoichthys calabaricus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4STP1_BCL2L1-      MPYSNKELVEDFISYKLSQKNFSCNQYFGDSRTATPGTSTPENEQDVLHV
A0A8C4XBF6_BCL2L1-      MSYSNRELVEDFISYKLSQKNVLNSQ----------------SELDVLQV
                        *.***.***************.  .*                .* ***:*

A0A8C4STP1_BCL2L1-      NGSVSGTENGGSSSADHSPDGIRAVKEALHDSGDEFELRYRAAFSDLSSQ
A0A8C4XBF6_BCL2L1-      N----GTGIINSFPATPASNGVKAVKEALRGSGDEFELRYRAAFNDLASQ
                        *    **   .* .*  :.:*:.******..*************.**:**

A0A8C4STP1_BCL2L1-      LHITPVTAYQSFEQVINELFRDGVNWGRIVALFAFGGALCVECVEKEMGS
A0A8C4XBF6_BCL2L1-      LHITPVTAYQSFEEVVGELFRDGVNWGRIVALFSFGGALCVECVEKEMVP
                        *************:*:.****************:************** .

A0A8C4STP1_BCL2L1-      LVKRIAEWMTTYLDNNLDPWIQRQGGWDTFAKIYGSNAAAECRRSQERFS
A0A8C4XBF6_BCL2L1-      LVRHIADWMTTYLDNNIDAWILSNGGWDTFVRIYGRHASAEY------FK
                        **..**:*********:*.**  :******..*** :*:**       *.

A0A8C4STP1_BCL2L1-      RWLLAGMTLATGLMLGSYFFHKRL
A0A8C4XBF6_BCL2L1-      KWLVVGVTMTAGLVLASFIAHTHL
                        .**:.*:*:::**:*.*:: *..*

© 1998-2022Legal notice