Dataset for protein Bcl-w of organism Equus caballus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5F5PML6_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL
A0A5F5PML6_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRA
A0A5F5PML6_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRA
                        **:.*:*. : . ...  .   *..  * ***  .***.....   .   

A0A5F5PML6_BCL2L2-      ESEELEP------EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSG---
A0A5F5PML6_BCL2L2-      AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG-GPNWGRLV
A0A5F5PML6_BCL2L2-      AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG-GPNWGRLV
                         .:*:*.      .:*  :    * . ::     :     * **. *   

A0A5F5PML6_BCL2L2-      ---------APGSQEEEEEPGLVEGDPGDGAIED----------------
A0A5F5PML6_BCL2L2-      AFFVFGAALCAESVNKEMEPLV-------GQVQEWMVAYLETRLADWIHS
A0A5F5PML6_BCL2L2-      AFFVFGAALCAESVNKEMEPLV-------GQVQEWMVAYLETRLADWIHS
                                 .. * ::* ** :       * :::                

A0A5F5PML6_BCL2L2-      ---PELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSI
A0A5F5PML6_BCL2L2-      SGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSI
A0A5F5PML6_BCL2L2-      SGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSI
                            **********************************************

A0A5F5PML6_BCL2L2-      EEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
A0A5F5PML6_BCL2L2-      EEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
A0A5F5PML6_BCL2L2-      EEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
                        **************************************************

A0A5F5PML6_BCL2L2-      GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
A0A5F5PML6_BCL2L2-      GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
A0A5F5PML6_BCL2L2-      GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
                        **************************************************

A0A5F5PML6_BCL2L2-      ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWRSCLILVNTFP
A0A5F5PML6_BCL2L2-      ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWRSCLILVNTFP
A0A5F5PML6_BCL2L2-      ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWFL---------
                        ***************************************           

A0A5F5PML6_BCL2L2-      LTLE
A0A5F5PML6_BCL2L2-      LTLE
A0A5F5PML6_BCL2L2-      ----
                            

© 1998-2020Legal notice