Dataset for protein BCL-2-like of organism Dicentrarchus labrax

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1X9JZA1_BCL2-01      MANECNRNIVEKYICHKLSKQGYEWGFDAVRNADAGNNGSIVAPPPSLVR
E6ZFR0_BCL2L1-01        -MSYSNRELVEFFISYKLSQRNH---------------------PTSLLR
                          . .**::** :*.:***:..:                     *.**:*

A0A1X9JZA1_BCL2-01      RCRGASTGPDSESIPHLCTRLPQSDPHAAIHRVLREAGDELERLYQPDFT
E6ZFR0_BCL2L1-01        PENAGERTEGDKANSAARNGLLASADIEAVKAALRDSADEFELLFTQAFS
                          ....   ..:: .   . *  *    *:: .**::.**:* *:   *:

A0A1X9JZA1_BCL2-01      EMSRQLYLTSTTAQRRFADVIDELFRDGVNWGRIIAFFEFGGTVCVECVA
E6ZFR0_BCL2L1-01        DLSSQIDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECVE
                        ::* *: :*. ** . * .*:**:*.********:.:* ***.:***** 

A0A1X9JZA1_BCL2-01      KEEMAAQVNNIAEWMTEYLNGPLNSWIQDNGGWDAFVELYDRQRDSVFSC
E6ZFR0_BCL2L1-01        K-DMSELVSRIADWMTMYLDEHISPWIQSQGGWDCFAEVFGRDAAAEARR
                        * :*:  *..**:*** **:  :..***.:****.*.*::.*:  :    

A0A1X9JZA1_BCL2-01      SWPSIKTVFGVAALGAASLTIGAYLTQK-
E6ZFR0_BCL2L1-01        SRETLSRWLLIGVALLMGAVVGVLIAKKH
                        *. ::.  : :..    . .:*. :::* 

© 1998-2022Legal notice