Dataset for protein Bcl-xL of organism Danio rerio

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


B2GRK1_BCL2L1-02      MSYYNRELVVFFIKYKLSQRNYPCNHIGLTEDTNRTDGAEENGEGAAGAT
B2GRK1_BCL2L1-01      MSYYNRELVVFFIKYKLSQRNYPCNHIGLTEDTNRTDGAEENGEGAAGAT
Q90Z98_BCL2L1-01      MSYYNRELVVFFIKYKLSQRNYPCNHIGLTEDTNRTDGAEENGEGAAGAT
                      **************************************************

B2GRK1_BCL2L1-02      TLVNGTMNRTNASSTGTPPQSPASSPQRQTNGSGGLDAVKEALRDSANEF
B2GRK1_BCL2L1-01      TLVNGTMNRTNASSTGTPPQSPASSPQRQTNGSGGLDAVKEALRDSANEF
Q90Z98_BCL2L1-01      TLVNGTMNRTNASSTGTPPQSPASSPQRQTNGSGGLDAVKEALRDSANEF
                      **************************************************

B2GRK1_BCL2L1-02      ELRYSRAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFG
B2GRK1_BCL2L1-01      ELRYSRAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFG
Q90Z98_BCL2L1-01      ELRYSRAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFG
                      **************************************************

B2GRK1_BCL2L1-02      GALCVECVEKEMSPLVGRIAEWMTVYLDNHIQPWIQSQGGWERFAEIFGK
B2GRK1_BCL2L1-01      GALCVECVEKEMSPLVGRIAEWMTVYLDNHIQPWIQSQGGWERFAEIFGK
Q90Z98_BCL2L1-01      GALCVECVEKEMSPLVGRIAEWMTVYLDNHIQPWIQSQGGWERFAEIFGK
                      **************************************************

B2GRK1_BCL2L1-02      DAAAESRKSQESFKKWLFAGMTLLTGVVVGGLIAQKRL
B2GRK1_BCL2L1-01      DAAAESRKSQESFKKWLFAGMTLLTGVVVGGLIAQKRL
Q90Z98_BCL2L1-01      DAAAESRKSQESFKKWLFAGMTLLTGVVVGGLIAQKRL
                      **************************************

© 1998-2023Legal notice