Dataset for protein Bcl-2 of organism Cyprinus carpio

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C1WYA7_BCL2-01      MANEIRYDNRNIVEKYLNHKLSKKGYEWKFQSSGEDDDTINTGVEDSSPS
X4ZGI8_BCL2-01          MANEIRYDNRNIVEKYLNHKLSKKGYEWKFQSSGEDDDTINTGVEDSSPS
A0A8C1IQE4_BCL2-01      MAQENVYDNRSIVEKYIHHKLWKKGYVWE---------------------
A0A8C2KJQ5_BCL2-02      MAQENVYDNRSIVVKYIHHKLWKKGYVWE---------------------
A0A8C1S8K5_BCL2-01      MAQENVYDNRSIVEKYIHHKLWKKGYVWEVNG------------HDDSVS
A0A8C2KJQ5_BCL2-01      MAQENVYDNRSIVVKYIHHKLWKKGYVWEVNG------------HDDRVS
                        **:*  ****.** **::*** **** *:                     

A0A8C1WYA7_BCL2-01      SDRRLQAPSAGGGNNSECLIANRVTRSDPYSRIYRSLREAGDQIERMYQR
X4ZGI8_BCL2-01          SDRRLQAPSAGGGNNSECLIANRVTRSDPYSRIYRSLREAGDQIERMYQR
A0A8C1IQE4_BCL2-01      --------EDRGG-----------TRHDPCSALHKVLREAGDELERLYQS
A0A8C2KJQ5_BCL2-02      --------EDRGG-----------TRHDPCSALHKVLREAGDELERLYQS
A0A8C1S8K5_BCL2-01      NGLMMERQEDRGG-----------TRHDPCSALHTVLREAGDELERLYQS
A0A8C2KJQ5_BCL2-01      NGLMMGRQEDRGG-----------TRHDPCSALHKVLREAGDELERLYQS
                                .  **           ** ** * ::  ******::**:** 

A0A8C1WYA7_BCL2-01      EFEEMSHQMTFSPSAAQRSFLAVAEELFRDGVNWGRIVAFFEFGGTMCVE
X4ZGI8_BCL2-01          EFEEMSHQMTFSPSAAQRSFLAVAEELFRDGVNWGRIVAFFEFGGTMCVE
A0A8C1IQE4_BCL2-01      DFAEMSKQLHLTSITAQQRFTAVIDELFRDGVNWGRIIAFFEFGGTVCVE
A0A8C2KJQ5_BCL2-02      DFAEMSKQLHLTSITAQQRFTAVIDELFRDGVNWGRIIAFFEFGGTVCVE
A0A8C1S8K5_BCL2-01      DFAEMSKQLHITSITAQQRFTAVIDELFRDGVNWGRIIAFFEFGGTVCVE
A0A8C2KJQ5_BCL2-01      DFAEMSKQLHLTSITAQQRFTAVIDELFRDGVNWGRIIAFFEFGGTVCVE
                        :* ***:*: ::. :**. * ** :************:********:***

A0A8C1WYA7_BCL2-01      SFNREMASQVDNIAHWMTDYLNGPLENWIEENGGWDAFVELYSQQRDSMF
X4ZGI8_BCL2-01          SFNREMASQVDNIAHWMTDYLNGPLENWIEENGGWDAFVELYSQQRDPMF
A0A8C1IQE4_BCL2-01      CVNKEMTAHVDNIAGWMTEYLNGPLHAWIQENGGWEAFVELYGRQRDSVF
A0A8C2KJQ5_BCL2-02      CVNKEMTAHVDNIAGWMTEYLNGPLHAWIQENGGWEAFVELYGRQRDSVF
A0A8C1S8K5_BCL2-01      CVNKEMTAHVDNIAGWMTEYLNGPLHAWIQENGGWEAFVELYGRQRDSVF
A0A8C2KJQ5_BCL2-01      CVNKEMTAHVDNIAGWMTEYLNGPLHAWIQENGGWEAFVELYGRQRDSVF
                        ..*.**:::***** ***:******  **:*****:******..***.:*

A0A8C1WYA7_BCL2-01      H-PLSYLTKVLGLAALGLAGVTIGAFFAQK
X4ZGI8_BCL2-01          H-PLSYLTKVLGLAALGLAGVTIGAFFAQK
A0A8C1IQE4_BCL2-01      RSSWSSIVTVFGLAALGAVGLTIGAYLAQK
A0A8C2KJQ5_BCL2-02      RSSWSSIVTVFGLAALGAVGLTIGAYLAQK
A0A8C1S8K5_BCL2-01      RSSWSSIVTVFGLAALGAVGLTIGAYLAQK
A0A8C2KJQ5_BCL2-01      RSSWSSIVTVFGLAALGAVGLTIGAYLAQK
                        . . * :..*:****** .*:****::***

© 1998-2022Legal notice