Dataset for protein Bcl-2 of organism Cyprinus carpio

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C1IQE4_BCL2-01      MAQENVYDNRSIVEKYIHHKLWKKGYVWEEDRGG----------------
X4ZGI8_BCL2-01          MANEIRYDNRNIVEKYLNHKLSKKGYEWKFQSSGEDDDTINTGVEDSSPS
                        **:*  ****.*****::*** **** *: : .*                

A0A8C1IQE4_BCL2-01      ------------------------TRHDPCSALHKVLREAGDELERLYQS
X4ZGI8_BCL2-01          SDRRLQAPSAGGGNNSECLIANRVTRSDPYSRIYRSLREAGDQIERMYQR
                                                ** ** * ::. ******::**:** 

A0A8C1IQE4_BCL2-01      DFAEMSKQLHLTSITAQQRFTAVIDELFRDGVNWGRIIAFFEFGGTVCVE
X4ZGI8_BCL2-01          EFEEMSHQMTFSPSAAQRSFLAVAEELFRDGVNWGRIVAFFEFGGTMCVE
                        :* ***:*: ::. :**. * ** :************:********:***

A0A8C1IQE4_BCL2-01      CVNKEMTAHVDNIAGWMTEYLNGPLHAWIQENGGWEAFVELYGRQRDSVF
X4ZGI8_BCL2-01          SFNREMASQVDNIAHWMTDYLNGPLENWIEENGGWDAFVELYSQQRDPMF
                        ..*.**:::***** ***:******  **:*****:******..***.:*

A0A8C1IQE4_BCL2-01      RSSWSSIVTVFGLAALGAVGLTIGAYLAQK
X4ZGI8_BCL2-01          H-PLSYLTKVLGLAALGLAGVTIGAFFAQK
                        . . * :..*:****** .*:****::***

© 1998-2023Legal notice