Dataset for protein Bcl-2 of organism Cyclopterus lumpus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2X310_BCL2-05      MSSEEGLSSTITDWLLINSWWLLLPFVMLLVVAAFIVAFVLLLYMISPLI
A0A8C2X310_BCL2-06      MANECNRN----------------------IVEKYIC-------------
A0A8C2X310_BCL2-03      MSSEEGLSSTITDWLLINSWWLLLPFVMLLVVAAFIVAFVLLLYMISPLI
A0A8C2X310_BCL2-02      MSSEEGLSSTITDWLLINSWWLLLPFVMLLVVAAFIVAFVLLLYMISPLI
A0A8C2X310_BCL2-04      ---------------------------MLLVVAAFIVAFVLLLYMISPLI
A0A8C2X310_BCL2-01      ---------------------------MLLVVAAFIVAFVLLLYMISPLI
                                                      :*  :*              

A0A8C2X310_BCL2-05      SPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARDE-------
A0A8C2X310_BCL2-06      ---------HKLSKRGYVFGFDDVRDEDAADDG----LIVVPPPTLVRRC
A0A8C2X310_BCL2-03      SPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARDEAKLLQAK
A0A8C2X310_BCL2-02      SPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARDEAKLLQAK
A0A8C2X310_BCL2-04      SPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARDEAKLLQAK
A0A8C2X310_BCL2-01      SPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARDEAKLLQAK
                                  ::   *   *:..    :.  :*    *:.          

A0A8C2X310_BCL2-05      -------------VNCLNNSVLTYWSGFFSV-AQAQEKLGPVDMLVNCAG
A0A8C2X310_BCL2-06      RESGTGPDIESVPHLCKRLPQSDPTAAIHRVLREAGDEL-----------
A0A8C2X310_BCL2-03      KELEKFAINDKQ-VYCLNNSVLTYWSGFFSV-AQAQEKLGPVDMLVNCAG
A0A8C2X310_BCL2-02      KELEKFAINDKQVVLCISVDVSSEYSQVESVIKQAQEKLGPVDMLVNCAG
A0A8C2X310_BCL2-04      KELEKFAINDKQVVLCISVDVSSEYSQVESVIKQAQEKLGPVDMLVNCAG
A0A8C2X310_BCL2-01      KELEKFAINDKQVVLCISVDVSSEYSQVESVIKQAQEKLGPVDMLVNCAG
                                       *         : .  *  :* ::*           

A0A8C2X310_BCL2-05      VSISGKFDEMEVDRFK----------------------------------
A0A8C2X310_BCL2-06      -------ERLYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRI
A0A8C2X310_BCL2-03      VSISGKFDEMEVDRFKKLMEVNYLGSVYPTRAVITTMKERRR-----GRI
A0A8C2X310_BCL2-02      VSISGKFDEMEVDRFKKLMEVNYLGSVYPTRAVITTMKERRR-----GRI
A0A8C2X310_BCL2-04      VSISGKFDEMEVDRFKKLMEVNYLGSVYPTRAVITTMKERRR-----GRI
A0A8C2X310_BCL2-01      VSISGKFDEMEVDRFKKLMEVNYLGSVYPTRAVITTMKERRR-----GRI
                               : :    *.                                  

A0A8C2X310_BCL2-05      --------------------------------------------------
A0A8C2X310_BCL2-06      IAFFEFGGTVC---------------------------------------
A0A8C2X310_BCL2-03      MFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPD
A0A8C2X310_BCL2-02      MFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPD
A0A8C2X310_BCL2-04      MFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPD
A0A8C2X310_BCL2-01      MFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPD
                                                                          

A0A8C2X310_BCL2-05      --------------------------------------------------
A0A8C2X310_BCL2-06      ----------------AECAAKQEMTSQVDNIAEWMT-EYLNGPLNNWIQ
A0A8C2X310_BCL2-03      TDTPGLAEENKTKPLETKLISETSGVCQPDQVAKIIVRDAVQGNFNSSVG
A0A8C2X310_BCL2-02      TDTPGLAEENKTKPLETKLISETSGVCQPDQVAKIIVRDAVQGNFNSSVG
A0A8C2X310_BCL2-04      TDTPGLAEENKTKPLETKLISETSGVCQPDQVAKIIVRDAI---------
A0A8C2X310_BCL2-01      TDTPGLAEENKTKPLETKLISETSGVCQPDQVAKIIVRDAVQGNFNSSVG
                                                                          

A0A8C2X310_BCL2-05      -------------------------IVTMGLFR----------------T
A0A8C2X310_BCL2-06      DNGGW--------------------DAFVELYDRQRDSLFNCSWPSIKTV
A0A8C2X310_BCL2-03      PDGYMLSALTCGMSPVTSITEGLQQIVTMGLFR----------------T
A0A8C2X310_BCL2-02      PDGYMLSALTCGMSPVTSITEGLQQIVTMGLFR----------------T
A0A8C2X310_BCL2-04      ------------------VTMGLFR------------------------T
A0A8C2X310_BCL2-01      PDGYMLSALTCGMSPVTSITEGLQQDAFVELYDRQRDSLFNCSWPSIKTV
                                                                         .

A0A8C2X310_BCL2-05      IALFYLGSFDSIVRRCMIQREQSKAADKRE
A0A8C2X310_BCL2-06      FGLAALGAASLTIGAYLTQK----------
A0A8C2X310_BCL2-03      IALFYLGSFDSIVRRCMIQREQSKAADKRE
A0A8C2X310_BCL2-02      IALFYLGSFDSIVRRCMIQREQSKAADKRE
A0A8C2X310_BCL2-04      IALFYLGSFDSIVRRCMIQREQSKAADKRE
A0A8C2X310_BCL2-01      FGLAALGAASLTIGAYLTQK----------
                        :.*  **: .  :   : *.          

© 1998-2022Legal notice