Dataset for protein Bcl-xL of organism Cricetulus griseus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


B2Z3Z4_BCL2L1-01      MSQSNRELVVDFLSYKFSQKGYSWSQFSDVEENRTEAPEGTESERETPSA
G3HEA7_BCL2L1-02      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESERETPSA
G3HEA7_BCL2L1-01      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESERETPSA
                      ****************:*********************************

B2Z3Z4_BCL2L1-01      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
G3HEA7_BCL2L1-02      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
G3HEA7_BCL2L1-01      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
                      **************************************************

B2Z3Z4_BCL2L1-01      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
G3HEA7_BCL2L1-02      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
G3HEA7_BCL2L1-01      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                      **************************************************

B2Z3Z4_BCL2L1-01      CVESVDKEMQVLVSRIASWMATYLNDHLEPWIQDNGGWDTFVELYGNNAA
G3HEA7_BCL2L1-02      CVESVDKEMQVLVSRIASWMATYLNDHLEPWIQDNGGWDTFVELYGNNAA
G3HEA7_BCL2L1-01      CVESVDKEMQVLVSRIASWMATYLNDHLEPWIQDNGGWDTFVELYGNNAA
                      **************************************************

B2Z3Z4_BCL2L1-01      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
G3HEA7_BCL2L1-02      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
G3HEA7_BCL2L1-01      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
                      *********************************

© 1998-2020Legal notice