Dataset for protein Mcl-1 of organism Coturnix japonica

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2TT61_MCL1-02      MFAVKRNAVIGFNLYCGGGGPGLVPASPAGDQPAPPAAAAAPAAATGSEV
A0A8C2TT61_MCL1-01      MFAVKRNAVIGFNLYCGGGGPGLVPASPAGDQPAPPAAAAAPAAATGSEV
                        **************************************************

A0A8C2TT61_MCL1-02      PRPLIGSAGLWASTGLAEAPRDPIGSGAAPHSPIGSGAAPHSPIGSEFAP
A0A8C2TT61_MCL1-01      PRPLIGSAGLWASTGLAEAPRDPIGSGAAPHSPIGSGAAPHSPIGSEFAP
                        **************************************************

A0A8C2TT61_MCL1-02      HSLIGPATARRAPSDSTPRPVALWSPEEELDGYEPESERGPGGDSLPGTP
A0A8C2TT61_MCL1-01      HSLIGPATARRAPSDSTPRPVALWSPEEELDGYEPESERGPGGDSLPGTP
                        **************************************************

A0A8C2TT61_MCL1-02      PELPDDELRRDSLELILRYLREAAGEAEPSVKKLFPGLLGGPGRPGKTGN
A0A8C2TT61_MCL1-01      PELPDDELRRDSLELILRYLREAAGEAEPSVKKLFPGLLGGPGRPGKTGN
                        **************************************************

A0A8C2TT61_MCL1-02      GVMEKALETLRRVGDGVMEKHELAFQGMLRKLEIKKEEDLQAVCEVAAHV
A0A8C2TT61_MCL1-01      GVMEKALETLRRVGDGVMEKHELAFQGMLRKLEIKKEEDLQAVCEVAAHV
                        **************************************************

A0A8C2TT61_MCL1-02      FSDGVTNWGRVVTLISFGAFVAKHLKSINQEKCISSLAGIITDALVSSKR
A0A8C2TT61_MCL1-01      FSDGVTNWGRVVTLISFGAFVAKHLKSINQEKCISSLAGIITDALVSSKR
                        **************************************************

A0A8C2TT61_MCL1-02      EWLMSQGGWEGFVDFFRVEDLEGSIRNVLMAFAGVAGLGASLAYMIR-WT
A0A8C2TT61_MCL1-01      EWLMSQGGWEGFVDFFRVEDLEGSIRNVLMAFAGVAGLGASLAYMIRKWR
                        *********************************************** * 

A0A8C2TT61_MCL1-02      -
A0A8C2TT61_MCL1-01      S
                         

© 1998-2022Legal notice