Dataset for protein Bcl-xL of organism Coregonus sp balchen

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A6F8ZUL6_BCL2L1-      -MSYSNRELVVFFISYKLSQRNYPCCQLVLEGASGRT---EGEEAIANGS
A0A6F9CY91_BCL2L1-      -MSYSNRELVVFFISYRLSQRNYSFCQLGLEGVSGRT---EGDEAIANGS
A0A6F9B188_BCL2L1-      MMTYNNRELVVYYITYKLSQRDYPFNHTGLTEAPSQTEGGEGGQVEGGAA
A0A6F9BJ02_BCL2L1-      MMTYNNRELVEYYITYKLSQRDYPFNHIGLTESQSRT---EGGPVDGSAA
                         *:*.***** ::*:*.****:*.  :  *    ..*   **  . ...:

A0A6F8ZUL6_BCL2L1-      LGNNRNGRSNLGKPSSP------------QGGIEAVKAALRDSVDEFELR
A0A6F9CY91_BCL2L1-      VGNNRNSRSNLGKPSSP------------LGGIEAVKAALRDSADEFELR
A0A6F9B188_BCL2L1-      VTTHPNGTVNGTSPGT-PPRQSPPSTPQRTMGLDAVKEALRDSANEFELR
A0A6F9BJ02_BCL2L1-      VMTYVNCTMNGTSPGTPPPRQSPPSSPRRTEGLDAVKEALRDSANEFELR
                        : .  *   *  .*.:               *::*** *****.:*****

A0A6F8ZUL6_BCL2L1-      YTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGAL
A0A6F9CY91_BCL2L1-      YTRAFSDLASQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGAL
A0A6F9B188_BCL2L1-      YARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGAL
A0A6F9BJ02_BCL2L1-      YARAFSDLASQLHITPSTAYQSFENVMDEVFRDGVNWGRVVGLFAFGGAL
                        *:******:*******:***:***.*************************

A0A6F8ZUL6_BCL2L1-      CIECVEKDMSHLVTRIADWMATYLDNHIQPWIQSQGGWDCFA--------
A0A6F9CY91_BCL2L1-      CVECVEKDMSPLVARIADWMTTYLDNHIQPWIQSQGGWDRFA--------
A0A6F9B188_BCL2L1-      CVECVEKEMSPLVGRIAEWMTVYLDNHIQPWIQSQGGWMKAAFSLGSAER
A0A6F9BJ02_BCL2L1-      CVECVDKEMSPLVGRITDWMTVYLDNHIQPWIQSQGGWVSHD--------
                        *:***:*:** ** **::**:.****************            

A0A6F8ZUL6_BCL2L1-      --------------------EIFGRDAAADVRRSQESLRKWLLVGVMLLS
A0A6F9CY91_BCL2L1-      --------------------EIFGRDAAADVRRSQESVIKWLLVGVILFS
A0A6F9B188_BCL2L1-      GVVLFLVGGCVMGWKEDTVKEIFGKDAAAESRKSQESFKKWLLAGMTLVT
A0A6F9BJ02_BCL2L1-      --------------------------------------------------
                                                                          

A0A6F8ZUL6_BCL2L1-      GVLVGTLIMKKRQ
A0A6F9CY91_BCL2L1-      GVLVGTLIMKKRQ
A0A6F9B188_BCL2L1-      GVVVGSLIAQKRL
A0A6F9BJ02_BCL2L1-      -------------
                                     

© 1998-2020Legal notice