Dataset for protein Bcl-xL of organism Coregonus sp balchen

[Download (right click)] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A6F9BJ02_BCL2L1-01      MMTYNNRELVEYYITYKLSQRDYPFNHIGLTESQSRTEGGP---VDGSAA
A0A6F9B188_BCL2L1-01      MMTYNNRELVVYYITYKLSQRDYPFNHTGLTEAPSQTEGGEGGQVEGGAA
A0A6F9CY91_BCL2L1-01      -MSYSNRELVVFFISYRLSQRNYSFCQLGLEGVSGRTEGDE---AIANGS
A0A6F8ZUL6_BCL2L1-02      -MSYSNRELVVFFISYKLSQRNYPCCQLVLEGASGRTEGEE---AIANGS
                           *:*.***** ::*:*:****:*.  :  *    .:***     . ...:

A0A6F9BJ02_BCL2L1-01      VMTYVNCTMNGTSPGTPPPRQSPPSSPRRTEGLDAVKEALRDSANEFELR
A0A6F9B188_BCL2L1-01      VTTHPNGTVNGTSPGTP-PRQSPPSTPQRTMGLDAVKEALRDSANEFELR
A0A6F9CY91_BCL2L1-01      VGNNRNSRSNL----------GKPSSP--LGGIEAVKAALRDSADEFELR
A0A6F8ZUL6_BCL2L1-02      LGNNRNGRSNL----------GKPSSP--QGGIEAVKAALRDSVDEFELR
                          : .  *   *           . **:*    *::*** *****.:*****

A0A6F9BJ02_BCL2L1-01      YARAFSDLASQLHITPSTAYQSFENVMDEVFRDGVNWGRVVGLFAFGGAL
A0A6F9B188_BCL2L1-01      YARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGAL
A0A6F9CY91_BCL2L1-01      YTRAFSDLASQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGAL
A0A6F8ZUL6_BCL2L1-02      YTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGAL
                          *:******:*******:***:***.*************************

A0A6F9BJ02_BCL2L1-01      CVECVDKEMSPLVGRITDWMTVYLDNHIQPWIQSQGGWVS----------
A0A6F9B188_BCL2L1-01      CVECVEKEMSPLVGRIAEWMTVYLDNHIQPWIQSQGGWMKAAFSLGSAER
A0A6F9CY91_BCL2L1-01      CVECVEKDMSPLVARIADWMTTYLDNHIQPWIQSQGGWDR----------
A0A6F8ZUL6_BCL2L1-02      CIECVEKDMSHLVTRIADWMATYLDNHIQPWIQSQGGWDC----------
                          *:***:*:** ** **::**:.****************            

A0A6F9BJ02_BCL2L1-01      --------------------------------------------------
A0A6F9B188_BCL2L1-01      GVVLFLVGGCVMGWKEDTVKEIFGKDAAAESRKSQESFKKWLLAGMTLVT
A0A6F9CY91_BCL2L1-01      ------------------FAEIFGRDAAADVRRSQESVIKWLLVGVILFS
A0A6F8ZUL6_BCL2L1-02      ------------------FAEIFGRDAAADVRRSQESLRKWLLVGVMLLS
                                                                            

A0A6F9BJ02_BCL2L1-01      -----------HD
A0A6F9B188_BCL2L1-01      GVVVGSLIAQKRL
A0A6F9CY91_BCL2L1-01      GVLVGTLIMKKRQ
A0A6F8ZUL6_BCL2L1-02      GVLVGTLIMKKRQ
                                     : 

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice