Dataset for protein Bfl1 of organism Colobus angolensis palliatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5KAA3_BCL2A1-      MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQEEVEK
A0A2K5KAA3_BCL2A1-      MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQEEVEK
                        **************************************************

A0A2K5KAA3_BCL2A1-      NLKPCLDNVNVASIDTARTIFNQVMEKEFEDGIINWGRIVTIFAFEGILI
A0A2K5KAA3_BCL2A1-      NLKPCLDNVNVASIDTARTIFNQVMEKEFEDGIINWGRIVTIFAFEGILI
                        **************************************************

A0A2K5KAA3_BCL2A1-      KKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGK--------
A0A2K5KAA3_BCL2A1-      KKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEP
                        **************************************** :        

A0A2K5KAA3_BCL2A1-      ---WHNHMPM---LVESVAHKKKKMAL
A0A2K5KAA3_BCL2A1-      KSGWMTFLEVTGKICEMLSLLKQYC--
                           * ..: :   : * ::  *:    

© 1998-2020Legal notice