Dataset for protein Bcl-w of organism Cebus imitator

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5RUN8_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGP
A0A2K5RUN8_BCL2L2-      -----------MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGA
A0A2K5RUN8_BCL2L2-      -----------MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGA
A0A2K5RUN8_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGP
A0A2K5RUN8_BCL2L2-      HLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGP
                                   **:.*:*. : . ...  .   *..  * ***  .***.

A0A2K5RUN8_BCL2L2-      AADPLHQAMRAAGDEFETRF----------------RRTFSDLAAQLHVT
A0A2K5RUN8_BCL2L2-      PGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAPPGAPGPGPG
A0A2K5RUN8_BCL2L2-      PGGAGDYGNGLESEELEPED------------------------------
A0A2K5RUN8_BCL2L2-      AADPLHQAMRAAGDEFETRF----------------RRTFSDLAAQLHVT
A0A2K5RUN8_BCL2L2-      AADPLHQAMRAAGDEFETRF----------------RRTFSDLAAQLHVT
                        ....   .    .:*:*.                                

A0A2K5RUN8_BCL2L2-      PGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQ
A0A2K5RUN8_BCL2L2-      SGAPGSQEEEEEPGLVEGDPGDGAI-------------------------
A0A2K5RUN8_BCL2L2-      ------QEEEEEPGLVEGDPGDGAI-------------------------
A0A2K5RUN8_BCL2L2-      PGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQ
A0A2K5RUN8_BCL2L2-      PGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQ
                              .  : .  *.:*.*. * :                         

A0A2K5RUN8_BCL2L2-      VQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVE
A0A2K5RUN8_BCL2L2-      --------------------EDPELEAIKARVREMEEEAEKLKELQNEVE
A0A2K5RUN8_BCL2L2-      --------------------EDPELEAIKARVREMEEEAEKLKELQNEVE
A0A2K5RUN8_BCL2L2-      VQEWMVAYLETRLADWIHSSGGWA-EFTALYGDGALEEARRLRE------
A0A2K5RUN8_BCL2L2-      VQEWMVAYLETRLADWIHSSGGWA-EFTALYGDGALEEARRLRE------
                                             .   *          *** .*.*      

A0A2K5RUN8_BCL2L2-      KQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHG
A0A2K5RUN8_BCL2L2-      KQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHG
A0A2K5RUN8_BCL2L2-      KQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHG
A0A2K5RUN8_BCL2L2-      ---------GNWASV------------RTVLTGAVALGALVT--------
A0A2K5RUN8_BCL2L2-      ---------GNWASV------------RTVLTGAVALGALVT--------
                                 ** ..*            *:: .* *  ** .         

A0A2K5RUN8_BCL2L2-      CGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKV
A0A2K5RUN8_BCL2L2-      CGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIK-
A0A2K5RUN8_BCL2L2-      CGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIK-
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5RUN8_BCL2L2-      DVKAFIYSSLTQVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFY
A0A2K5RUN8_BCL2L2-      ------------VIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFY
A0A2K5RUN8_BCL2L2-      ------------VIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFY
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5RUN8_BCL2L2-      SGFNSRPRGRVYRGRARATSWYSPY
A0A2K5RUN8_BCL2L2-      SGFNSRPRGRVYRGRARATSWYSPY
A0A2K5RUN8_BCL2L2-      SGFNSRPRGRVYRGRARATSWYSPY
A0A2K5RUN8_BCL2L2-      -----------------VGAFFASK
A0A2K5RUN8_BCL2L2-      -----------------VGAFFASK
                                         . ::::. 

© 1998-2021Legal notice