Dataset for protein Bfl1 of organism Capra hircus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A452EK63_BCL2A1-      -------------------------------MTDTEFDYVHKLAEDYLKY
A0A8C2RKE2_BCL2A1-      MFRQAPQACASDCLGHLQVSRLKTLLPSKEKMTDTEFDYVHKLAEDYLKY
                                                       *******************

A0A452EK63_BCL2A1-      VLQIQQPGSKPSKTSRVLQDVASSVQDEVERTLKQCLDKFDVVSVDTART
A0A8C2RKE2_BCL2A1-      VLQIQQPGSKPSKTSRVLQDVASSVQDEVERTLKQCLDKFDVVSVDTART
                        **************************************************

A0A452EK63_BCL2A1-      IFNQVMEKEFEDGIVNWGRIVTIFAFEGILTKKLLSKRIASDMDMCKDIS
A0A8C2RKE2_BCL2A1-      IFNQVMEKEFEDGIVNWGRIVTIFAFEGILTKKLLSKRIASDMDMCKDIS
                        **************************************************

A0A452EK63_BCL2A1-      YFVAEFITENTGEWIRQNGGWENGFVKKFETKSGWLTFLEVTGKICETLC
A0A8C2RKE2_BCL2A1-      YFVAEFITENTGEWIRQNGGWENGFVKKFETKSGWLTFLEVTGKICETLC
                        **************************************************

A0A452EK63_BCL2A1-      RLKQYY
A0A8C2RKE2_BCL2A1-      RLKQYY
                        ******

© 1998-2022Legal notice