Dataset for protein Mcl-1 of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5F4BWG4_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGRLL--------------
A0A5F4BWG4_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGRLLASGKEATTRREGGG
Q8HYS5_MCL1-01          MFGLKRNAVIRTQLYCGGAGLGAGSGGASSSGGRLLASGREATTRREGGG
                        **********  :***********************              

A0A5F4BWG4_MCL1-02      --------------------------------------------------
A0A5F4BWG4_MCL1-01      GEAGAVIGGSAGASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLA
Q8HYS5_MCL1-01          GEAGAVIGGSAGASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLA
                                                                          

A0A5F4BWG4_MCL1-02      --------------------------------------------------
A0A5F4BWG4_MCL1-01      PPCRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
Q8HYS5_MCL1-01          PPCRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
                                                                          

A0A5F4BWG4_MCL1-02      ---------------------------------------ATGAKDAKPLG
A0A5F4BWG4_MCL1-01      SSGPGMDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLG
Q8HYS5_MCL1-01          SSGPGMDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLG
                                                               ***********

A0A5F4BWG4_MCL1-02      GSRAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVI
A0A5F4BWG4_MCL1-01      GSRAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVI
Q8HYS5_MCL1-01          GSRAASRKALETLQRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVI
                        *************.************************************

A0A5F4BWG4_MCL1-02      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A5F4BWG4_MCL1-01      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
Q8HYS5_MCL1-01          VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
                        **************************************************

A0A5F4BWG4_MCL1-02      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A5F4BWG4_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Q8HYS5_MCL1-01          TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                        **************************************************

© 1998-2022Legal notice