Dataset for protein Mcl-1 of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F1PAP1_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGRLL------------------------
F1PAP1_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGRLLASGKEATTRREGGGGEAGAVIGGS
Q8HYS5_MCL1-01      MFGLKRNAVIRTQLYCGGAGLGAGSGGASSSGGRLLASGREATTRREGGGGEAGAVIGGS
                    **********  :***********************                        

F1PAP1_MCL1-02      ------------------------------------------------------------
F1PAP1_MCL1-01      AGASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLAPPCRASPPEEMEGPAADAIM
Q8HYS5_MCL1-01      AGASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLAPPCRASPPEEMEGPAADAIM
                                                                                

F1PAP1_MCL1-02      ------------------------------------------------------------
F1PAP1_MCL1-01      SPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGMDGSLPSTPPPAEEEEDELYRQSLE
Q8HYS5_MCL1-01      SPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGMDGSLPSTPPPAEEEEDELYRQSLE
                                                                                

F1PAP1_MCL1-02      ---------ATGAKDAKPLGGSRAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
F1PAP1_MCL1-01      IISRYLREQATGAKDAKPLGGSRAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
Q8HYS5_MCL1-01      IISRYLREQATGAKDAKPLGGSRAASRKALETLQRVGDGVQRNHETAFQGMLRKLDIKNE
                             ************************.**************************

F1PAP1_MCL1-02      DDVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
F1PAP1_MCL1-01      DDVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
Q8HYS5_MCL1-01      DDVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
                    ************************************************************

F1PAP1_MCL1-02      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
F1PAP1_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Q8HYS5_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                    **************************************************

© 1998-2020Legal notice