Dataset for protein Mcl-1 of organism Bos mutus grunniens

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9W7D1_MCL1-04      MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLL---------------
A0A8B9W7D1_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGG
A0A8B9W7D1_MCL1-03      MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGG
A0A8B9W7D1_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGG
                        ***********************************               

A0A8B9W7D1_MCL1-04      --------------------------------------------------
A0A8B9W7D1_MCL1-02      EAGTVIGGSAGPSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAP
A0A8B9W7D1_MCL1-03      EAGTVIGGSAGPSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAP
A0A8B9W7D1_MCL1-01      EAGTVIGGSAGPSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAP
                                                                          

A0A8B9W7D1_MCL1-04      --------------------------------------------------
A0A8B9W7D1_MCL1-02      TRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLPLLVGEAS
A0A8B9W7D1_MCL1-03      TRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLPLLVGEAS
A0A8B9W7D1_MCL1-01      TRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLPLLVGEAS
                                                                          

A0A8B9W7D1_MCL1-04      ---------------------------------------ATGAKDAKPLG
A0A8B9W7D1_MCL1-02      NNSPGSDGSLPSTPPPAEEEEDELYRQSLEIISQYLREQATGAKDAKPLG
A0A8B9W7D1_MCL1-03      NNSPGSDGSLPSTPPPAEEEEDELYRQSLEIISQYLREQATGAKDAKPLG
A0A8B9W7D1_MCL1-01      NNSPGSDGSLPSTPPPAEEEEDELYRQSLEIISQYLREQATGAKDAKPLG
                                                               ***********

A0A8B9W7D1_MCL1-04      GSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A8B9W7D1_MCL1-02      GSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A8B9W7D1_MCL1-03      GSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A8B9W7D1_MCL1-01      GSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
                        **************************************************

A0A8B9W7D1_MCL1-04      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A8B9W7D1_MCL1-02      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A8B9W7D1_MCL1-03      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A8B9W7D1_MCL1-01      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
                        **************************************************

A0A8B9W7D1_MCL1-04      SKRDWIVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A8B9W7D1_MCL1-02      SKRDWIVKQRGWVSLF----------------------------------
A0A8B9W7D1_MCL1-03      SKRDWIVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A8B9W7D1_MCL1-01      SKRDWIVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAVDTRLYTEPADVMV
                        ************ .:.                                  

A0A8B9W7D1_MCL1-04      ----
A0A8B9W7D1_MCL1-02      ----
A0A8B9W7D1_MCL1-03      ----
A0A8B9W7D1_MCL1-01      CNLV
                            

© 1998-2022Legal notice