Dataset for protein Mcl-1 of organism Bos mutus grunniens

[Download (right click)] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8B9W7D1_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGG
A0A8B9W7D1_MCL1-03      MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGG
A0A8B9W7D1_MCL1-04      MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLA--------------
A0A8B9W7D1_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGG
                        ************************************              

A0A8B9W7D1_MCL1-01      EAGTVIGGSAGPSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAP
A0A8B9W7D1_MCL1-03      EAGTVIGGSAGPSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAP
A0A8B9W7D1_MCL1-04      --------------------------------------------------
A0A8B9W7D1_MCL1-02      EAGTVIGGSAGPSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAP
                                                                          

A0A8B9W7D1_MCL1-01      TRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLPLLVGEAS
A0A8B9W7D1_MCL1-03      TRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLPLLVGEAS
A0A8B9W7D1_MCL1-04      --------------------------------------------------
A0A8B9W7D1_MCL1-02      TRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLPLLVGEAS
                                                                          

A0A8B9W7D1_MCL1-01      NNSPGSDGSLPSTPPPAEEEEDELYRQSLEIISQYLREQATGAKDAKPLG
A0A8B9W7D1_MCL1-03      NNSPGSDGSLPSTPPPAEEEEDELYRQSLEIISQYLREQATGAKDAKPLG
A0A8B9W7D1_MCL1-04      ----------------------------------------TGAKDAKPLG
A0A8B9W7D1_MCL1-02      NNSPGSDGSLPSTPPPAEEEEDELYRQSLEIISQYLREQATGAKDAKPLG
                                                                **********

A0A8B9W7D1_MCL1-01      GSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A8B9W7D1_MCL1-03      GSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A8B9W7D1_MCL1-04      GSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A8B9W7D1_MCL1-02      GSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
                        **************************************************

A0A8B9W7D1_MCL1-01      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A8B9W7D1_MCL1-03      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A8B9W7D1_MCL1-04      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A8B9W7D1_MCL1-02      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
                        **************************************************

A0A8B9W7D1_MCL1-01      SKRDWIVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAVDTRLYTEPADVMV
A0A8B9W7D1_MCL1-03      SKRDWIVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGL----A
A0A8B9W7D1_MCL1-04      SKRDWIVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGL----A
A0A8B9W7D1_MCL1-02      SKRDWIVKQRGWV-------------------------------------
                        ************                                      

A0A8B9W7D1_MCL1-01      CNLV
A0A8B9W7D1_MCL1-03      YLIR
A0A8B9W7D1_MCL1-04      YLIR
A0A8B9W7D1_MCL1-02      -SLF
                          : 

© 1998-2024Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice