Dataset for protein Bcl-xL of organism Astyanax mexicanus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B1JJ42_BCL2L1-      VMSYYNRELVVYFIKYKLSQRNYPTNHIGLMEETNRTEGGQEAEGNAEAA
A0A8B9LKW7_BCL2L1-      -MSYYNRELVVYFIKYKLSQRNYPTNHIGLVEETNRTEGGQEAEGNAEAA
                         *****************************:*******************

A0A3B1JJ42_BCL2L1-      GVTPTAVVNGSVNGTSHGAAGSPTSSPQRRANGARGLDAVKEALRDSANE
A0A8B9LKW7_BCL2L1-      AVTPTAVVNGSVNGTSHGAAGSPTSSPQRRANGARGLDAVKEALRDSANE
                        .*************************************************

A0A3B1JJ42_BCL2L1-      FELRYSRAFSDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRVVGLFAF
A0A8B9LKW7_BCL2L1-      FELRYSRAFSDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRVVGLFAF
                        **************************************************

A0A3B1JJ42_BCL2L1-      GGALCVECVEKEMSPLVGRIAEWMTVYLDNHIQPWIQEQGGWERFAEIFG
A0A8B9LKW7_BCL2L1-      GGALCVECVEKEMSPLVGRIAEWMTVYLDNHIQPWIQEQGGWERFAEIFG
                        **************************************************

A0A3B1JJ42_BCL2L1-      NDTAAESRRMQERYKMWLLVGMTLFTGIVVGSLIAQKRL
A0A8B9LKW7_BCL2L1-      NDTAAESRRMQERYKMWLLVGMTLFTGIVVGSLIAQKRL
                        ***************************************

© 1998-2022Legal notice