Dataset for protein Mcl-1 of organism Astatotilapia calliptera

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8NP63_MCL1-01      MANYMMLKRNQCTLMEYLIPQNGVLEGPMHYGSGNSSPQNATGSSKDSSN
A0A3P8NP63_MCL1-02      MANYMMLKRNQCTLMEYLIPQNGVLEGPMHYGSGNSSPQNATGSSKDSSN
                        **************************************************

A0A3P8NP63_MCL1-01      GIVSNGTPKRPDNLEVTSTNGYKTKAIRDREEDGSLPSTPEFHSDSESDE
A0A3P8NP63_MCL1-02      GIVSNGTPKRPDNLEVTSTNGYKTKAIRDREEDGSLPSTPEFHSDSESDE
                        **************************************************

A0A3P8NP63_MCL1-01      QLERETKLLIHSFLGDFIGLSQPQRKETKALKTMKRVVADVLEKHRYAYN
A0A3P8NP63_MCL1-02      QLERETKLLIHSFLGDFIGLSQPQRKETKALKTMKRVVADVLEKHRYAYN
                        **************************************************

A0A3P8NP63_MCL1-01      GMINKLSLDERDEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGAVVSQHL
A0A3P8NP63_MCL1-02      GMINKLSLDERDEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGAVVSQHL
                        **************************************************

A0A3P8NP63_MCL1-01      KEKGRDNYVALVSQEISAYLLSEQRDWIVKNNAWDGFVEFFRVADPESIV
A0A3P8NP63_MCL1-02      KEKGRDNYVALVSQEISAYLLSEQRDWIVKNNAWDGFVEFFRVADPESIV
                        **************************************************

A0A3P8NP63_MCL1-01      RHTLMAFAGFAGIGATLALLISCWDALL
A0A3P8NP63_MCL1-02      RHTLMAFAGFAGIGATLALLIRS-STIF
                        ********************* . .:::

© 1998-2020Legal notice