Dataset for protein Bcl-w of organism Ailuropoda melanoleuca

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1LKF5_BCL2L2-02      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
G1LKF5_BCL2L2-01      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
                      **************************************************

G1LKF5_BCL2L2-02      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
G1LKF5_BCL2L2-01      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
                      **************************************************

G1LKF5_BCL2L2-02      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIK
G1LKF5_BCL2L2-01      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIK
                      **************************************************

G1LKF5_BCL2L2-02      ARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARS
G1LKF5_BCL2L2-01      ARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARS
                      **************************************************

G1LKF5_BCL2L2-02      IYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDK
G1LKF5_BCL2L2-01      IYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDK
                      **************************************************

G1LKF5_BCL2L2-02      ESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNY
G1LKF5_BCL2L2-01      ESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNY
                      **************************************************

G1LKF5_BCL2L2-02      NSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
G1LKF5_BCL2L2-01      NSSRSRFYSGFNSRPRGRVYRGRARATSWFL--
                      *****************************:   

© 1998-2022Legal notice