Dataset for protein Bok of organism Cyprinus carpio

[Download (right click)] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8C1WZY9_BOK-01      ----MRVFERSSVIAAEMM-MEV-FDRTPTEKDLVSQSKELCRDFIHSRI
A0A8C1WP68_BOK-01      MRHVMNARERSSVFSAEMMMMEVKFDRTPTEKELVYQSKELCRYFIHSRI
A0A8C1MUT3_BOK-01      MRHVMNARERSSVFSAEMMMMEVKFDRTPTEKELVYQSKELCRYFIHSRI
A0A8C1J6C3_BOK-03      ------MLRRSSVFAAEVM--EV-FDRSPTDKELVSQSKVLCRDYIHSRL
A0A8C1GQG6_BOK-01      ----MEMLRRSSVFAAEVM--EV-FDRSPTDKELVSQSKVLCRDYIHSRL
A0A8C1J6C3_BOK-01      ----MEMLRRSSVFAAEVM--EV-FDRSPTDKELVSQSKVLCRDYIHSRL
A0A8C1J6C3_BOK-02      MKG-MEMLRRSSVFAAEVM--EV-FDRSPTDKELVSQSKVLCRDYIHSRL
A0A8C2GQ45_BOK-01      MSCDLSEVKINTCISASSK-------PNRRLQKMKIKT--------HL-S
A0A8C2GQ45_BOK-02      MSCDLSEVKINTCISASSK-------PNRRLRNVLQHSYKVCLCLTHCKV
A0A8C1I082_BOK-01      MRDVMNARERSSVFSAEMMMMEVKFDRTPTEKELVYQSKELCRYFIHSRI
A0A8C1WP68_BOK-02      MRHVMNARERSSVFSAEMMMMEVKFDRTPTEKELVYQSKELCRYFIHSRI
                               . .: ::*.          .   :.:  ::        *   

A0A8C1WZY9_BOK-01      IREGLSWSKVESDLPEPHEALVDVSVVLLKLGDELECMHPYVYRNIAKQL
A0A8C1WP68_BOK-01      VREGLSWSDLPE----PHGAFVDISVVLLKLGDELECMRPYVYRNIAKQL
A0A8C1MUT3_BOK-01      VREGLSWSDLPE----PHGAFVDISVVLLKLGDELECMRPYVYRNIAKQL
A0A8C1J6C3_BOK-03      HREH--W----------------LRCLQFFCGDELEYLRPNVYRNVARQL
A0A8C1GQG6_BOK-01      HLAGIGWSKPEHG---SGGTLAEVSSVLLWLGDELEYLRPNVYRNVARQL
A0A8C1J6C3_BOK-01      HRAGIGWSKPEHG---SGGTLAEVSSVLLWLGDELEYLRPNVYRNVARQL
A0A8C1J6C3_BOK-02      HRAGIGWSKPEHG---SGGTLAEVSSVLLWLGDELEYLRPNVYRNVARQL
A0A8C2GQ45_BOK-01      L-------------------------CLL--GDELEYLRPNVYRNVARQL
A0A8C2GQ45_BOK-02      L-------------------------CLLYQCDELEYLRPNVYRNVARQL
A0A8C1I082_BOK-01      VREGLSWSDLPE----PHGAFVDISVVLLKLGDELECMRPYVYRNIAKQL
A0A8C1WP68_BOK-02      VREGLSWSDLPE----PHGAFVDISVVLLKLGDELECMRPYVYRNIAKQL
                                                   :   **** ::* ****:*:**

A0A8C1WZY9_BOK-01      NISVAVEAVVSHAFFSVATEILVMG-------------------------
A0A8C1WP68_BOK-01      NISVAVEAVVSDAFLSVATEILVMG--------------ITWGKVVAIYA
A0A8C1MUT3_BOK-01      NISVAVEAVVSDAFLSVATEILVMG--------------ITWGKVVAIYA
A0A8C1J6C3_BOK-03      NITIASESIVSDAFLAVAAEIFSTG--------------VTWGKIVSLYA
A0A8C1GQG6_BOK-01      NITIASETIVSDAFLAVAAEIFSTGWSMPSLNIHNIHKRVTWGKIVSLYA
A0A8C1J6C3_BOK-01      NITIASESIVSDAFLAVAAEIFSTGNYFRKYTLEK-YPGVTWGKIVSLYA
A0A8C1J6C3_BOK-02      NITIASESIVSDAFLAVAAEIFSTG--------------VTWGKIVSLYA
A0A8C2GQ45_BOK-01      NITIASESIVSDAFLAVAAEIFSTGWSI-KYTLEK-YPGVTWGKIVSLYA
A0A8C2GQ45_BOK-02      NITIASESIVSDAFLAVAAEIFST--------------GVTWGKIVSLYA
A0A8C1I082_BOK-01      NISVAVEAVVSDAFLSVATEILVMG--------------ITWGKVVAIYA
A0A8C1WP68_BOK-02      NISVAVEAVVSDAFLSVATEILVMG--------------ITWGKVVAIYA
                       **::* *::**.**::**:**:                            

A0A8C1WZY9_BOK-01      -------------------NMAVCYGRFKGVRL-----------------
A0A8C1WP68_BOK-01      VAAGLAVDCVRQGHPVMVHTIVDSLGEFVRRNLVPWLKKRGGWVSVHSLF
A0A8C1MUT3_BOK-01      VAAGLAVDCVRQGHPVMVHTIVDSLGEFVRRNLVPWLKKRGGWRDILKCV
A0A8C1J6C3_BOK-03      VAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLVSWLKRRGGWADITKCV
A0A8C1GQG6_BOK-01      VAGALAVDCVRHAHPAMVHTIVDCMGEFVRKSLVSWLKRRGGWADITKCV
A0A8C1J6C3_BOK-01      VAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLVSWLKRRGGWADITKCV
A0A8C1J6C3_BOK-02      VAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLVSWLKRRGGWADITKCV
A0A8C2GQ45_BOK-01      VAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLVSWLKRRGGWADITKCV
A0A8C2GQ45_BOK-02      VAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLVSWLKRRGGWADITKCV
A0A8C1I082_BOK-01      VAAGLAVDCVRQGHPVMVHTIVDSLGEFVRRNLVPWLKKRGGWRDILKCV
A0A8C1WP68_BOK-02      VAAGLAVDCVRQGHPVMVHTIVDSLGEFVRRNLVPWLKKRGGWRDILKCV
                                          .:. . *.*    *                 

A0A8C1WZY9_BOK-01      -------------------------------PVTSSAQLDLYLTFVIFII
A0A8C1WP68_BOK-01      CHLHEPSLVLTSRGQHEEIKYCYSPVDAVLVLLIIFLVLLQFHTILVFLV
A0A8C1MUT3_BOK-01      VNM-DSRAR-------------------AHWLSTAVFTWRQFLKTMYIYL
A0A8C1J6C3_BOK-03      VNT-DPSFR-------------------SHWLVAAACACGHYLKAVVFYL
A0A8C1GQG6_BOK-01      VNT-DPSFR-------------------SHWLVAAACACGHYLKAVVFYL
A0A8C1J6C3_BOK-01      VNT-DPSFR-------------------SHWLVAAACACGHYLKAVVFYL
A0A8C1J6C3_BOK-02      VNT-DPSFR-------------------SHWLVAAACACGHYLKAVVFYL
A0A8C2GQ45_BOK-01      VNT-DPSFR-------------------SHWLVAAACACGHYLKAVVFYL
A0A8C2GQ45_BOK-02      VNT-DPSFR-------------------SHWLVAAACACGHYLKAVVFYL
A0A8C1I082_BOK-01      VNM-DSRAR-------------------AHWLSTAVFTWRQFLKTMYIYL
A0A8C1WP68_BOK-02      VNM-DSRAR-------------------AHWLSTAVFTWRQFLKTMYIYL
                                                                : . : : :

A0A8C1WZY9_BOK-01      YRYKSILHIFLKCIH
A0A8C1WP68_BOK-01      WFF-----------F
A0A8C1MUT3_BOK-01      --T-----------K
A0A8C1J6C3_BOK-03      LRE-----------K
A0A8C1GQG6_BOK-01      LRE-----------K
A0A8C1J6C3_BOK-01      LRE-----------K
A0A8C1J6C3_BOK-02      LRE-----------K
A0A8C2GQ45_BOK-01      LRE-----------K
A0A8C2GQ45_BOK-02      LRE-----------K
A0A8C1I082_BOK-01      --T-----------K
A0A8C1WP68_BOK-02      --T-----------K
                                      

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice