Dataset for protein Bak1 of organism Cercocebus atys

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5KTN5_BAK1-03      MASGQGPGFPRQECGELALPSASEEQVTRDMEKVFD-----RHQQEQEAE
A0A2K5KTN5_BAK1-02      MASGQGPGFPRQECGELALPSASEEQVTRDMEKVFD-----RHQQEQEAE
A0A2K5N1I8_BAK1-02      MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAE
A0A2K5N1I8_BAK1-01      MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAE
                        ******** ******* **********:** *:**      *********

A0A2K5KTN5_BAK1-03      G-----------------STVGQVGRQI----------------TMLQHL
A0A2K5KTN5_BAK1-02      GPAAPADPEMVTLPLQPSSTVGQVGRQI----------------TMLQHL
A0A2K5N1I8_BAK1-02      GAAAPADPEMDTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQQL
A0A2K5N1I8_BAK1-01      GAAAPADPEMDTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQQL
                        *                 **:******:                ****:*

A0A2K5KTN5_BAK1-03      QRTAENAYEYFTKIAS----------SLFESGINQGRVVALLGFSYHLVL
A0A2K5KTN5_BAK1-02      QRTAENAYEYFTKIAS----------SLFESGINQGRVVALLGFSYHLVL
A0A2K5N1I8_BAK1-02      QPTAENAYEYFTKIASRPAATPTACLRVASTGAVW---------------
A0A2K5N1I8_BAK1-01      QPTAENAYEYFTKIAS----------SLFESGINWGRVVALLGFGYRLAL
                        * **************           : .:*  .               

A0A2K5KTN5_BAK1-03      HVYQRGLTGFLGQVTRFVV-FMLQHCIAWWIAQRGSWVAALDLGNGPILN
A0A2K5KTN5_BAK1-02      HVYQRGLTGFLGQVTRFVV-FMLQHCIAWWIAQRGSWVAALDLGNGPILN
A0A2K5N1I8_BAK1-02      --------------------WLFWASATVW----------------PYTS
A0A2K5N1I8_BAK1-01      HVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILN
                                            :::. . : *                *  .

A0A2K5KTN5_BAK1-03      MLVILGVVLLGPFVVQRFFKS
A0A2K5KTN5_BAK1-02      MLVILGVVLLGPFVVQRFFKS
A0A2K5N1I8_BAK1-02      TSTA-----------------
A0A2K5N1I8_BAK1-01      VLVVLGVVLLGQFVVRRFFKS
                          .                  

© 1998-2020Legal notice