Dataset for protein BAX-like of organism Cavia porcellus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A286Y2U9_BAX-02      ------------------MDGSGEHPRGSGPTS-----SEHIMKTGALLL
H0UT71_BAK1-01         ---------------MASDQGPGPLREGCGGASPLSEEEQQVVRDTEEVF
A0A286XGM4_BOK-01      VRIRLVAMGLGEVKWRSAWRSWGPSQPGMGAVS-----HSHVCPP-----
A0A286Y2U9_BAX-01      ------------------MDGSGEHPRGSGPTS-----SEHIMKTGALLL
                                           . *    * * .*      .::        

A0A286Y2U9_BAX-02      QG------------------------------------------------
H0UT71_BAK1-01         QSYVYHRHQQDRGGTQGRVPRAHPTAHCCFLSSTLTQVGCQLAIIGDDIN
A0A286XGM4_BOK-01      --------------------------------------GDELEQIRPSVY
A0A286Y2U9_BAX-01      QGFIQDRAGRMGGDTLELAMEPAPQ------DASTKKLGECLKRIGDELD
                                                                         

A0A286Y2U9_BAX-02      -----------MIAAVDTDSPREVFFRVAAEMFADGNFNWGRVVALFYFA
H0UT71_BAK1-01         RRYGSDIEAMLQQLQPTADNAPDLFYKIACSLFKPG-PTWGRVVALLAFG
A0A286XGM4_BOK-01      R----NVARQLHISLQSEPVVTDAFLAVAGHIFSAG-ITWGKVVSLYSVA
A0A286Y2U9_BAX-01      S----NMELQRMIAAVDTDSPREVFFRVAAEMFADGNFNWGRVVALFYFA
                                             : *  :*  :*  *  .**.**:*  ..

A0A286Y2U9_BAX-02      SKLVLK--------------------------------------------
H0UT71_BAK1-01         YRLALHVYQQHGLSGFLGKVTRLVVDSMLQL---NVVRWIVEKGGWVAAL
A0A286XGM4_BOK-01      AGLAVDCVRQA-----QPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVL
A0A286Y2U9_BAX-01      SKLVLKALCTK-----VPELIRTIMGWTLDFLRDRLLSWIQDQGGWDGLL
                         *.:                                             

A0A286Y2U9_BAX-02      -------------------------------------
H0UT71_BAK1-01         DWAGT----FRPIWTVVTAFAIVMVGQYVIRRFFKSS
A0A286XGM4_BOK-01      KCVVSTDPSLHSHWLVAALCNFGRFLKAAFFVLLPER
A0A286Y2U9_BAX-01      SYFGT------PTWQTVTIFVAG-VLTASLTIWKNMG
                                                            

© 1998-2020Legal notice