Dataset for protein BAX-like of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F1PAN9_BAX-01       ---MDGSGEQPRGGG-----PTSSEQIMKTGALLLQGFI-------QDRAGRMGGETPEL
Q8HYU5_BAX-01       ---MDGSGEQPRGGG-----PTSSEQIMKTGALLLQGFI-------QDRAGRMGGETPEL
F6PMP8_BAK1-03      MASGQGPGPPRRECGEAAPSSTSEEQVARDTEEVFRSYVFYRHRQEQEAEGAAVPADPEM
F6PMP8_BAK1-01      MASGQGPGPPRRECGEAAPSSTSEEQVARDTEEVFRSYVFYRHRQEQEAEGAAVPADPEM
F6PMP8_BAK1-02      MASGQGPGPPRRECGEAAPSSTSEEQVARDTEEVFRSYVFYRHRQ---------------
Q52HB2_BAK1-01      MASGQGPGPPRRECGEAAPSSTSEEQVARDTEEVFRSYVFYRHRQEQEAEGAAVPADPEM
                        :*.*   *  *     .**.**: .    ::..::                     

F1PAN9_BAX-01       PLEQVPQDASTKKLSECLKRIGDELDS--NMELQRMIAAVD--TDSPREVFFRVAAEMFS
Q8HYU5_BAX-01       PLEQVPQDASTKKLSECLKRIGDELDS--NMELQRMIAAVD--TDSPREVFFRVAAEMFS
F6PMP8_BAK1-03      VTLPLEPSSTMGQVGRQLAIIGDDINQRYDSEFQAMLQHLQPTAENAYEYFTKIASRPAA
F6PMP8_BAK1-01      VTLPLEPSSTMGQVGRQLAIIGDDINQRYDSEFQAMLQHLQPTAENAYEYFTKIASSLFE
F6PMP8_BAK1-02      -----EPSSTMGQVGRQLAIIGDDINQRYDSEFQAMLQHLQPTAENAYEYFTKIASSLFE
Q52HB2_BAK1-01      VTLPLEPSSTMGQVGRQLAIIGDDINQRYDSEFQAMLQHLQPTAENAYEYFTKIASSLFE
                           .::  ::.  *  ***:::.  : *:* *:  ::  ::.. * * .:*:    

F1PAN9_BAX-01       DGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLG-WIQDQGGWVS
Q8HYU5_BAX-01       DGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLG-WIQDQGGWDG
F6PMP8_BAK1-03      TP-TAYLRAAS-----------------TG------------------AEW------WLS
F6PMP8_BAK1-01      SG-INWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLHHCIARWIAQRGGWVA
F6PMP8_BAK1-02      SG-INWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLHHCIARWIAQRGGWVA
Q52HB2_BAK1-01      SG-INWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLHHCIARWIAQRGGWVA
                         : *..:                 .                   . *      * .

F1PAN9_BAX-01       LQSRRSRRPL----------------VWKPTGLCWR------------------------
Q8HYU5_BAX-01       LLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG----------------------------
F6PMP8_BAK1-03      WALATAWPCMSTNAA---------------------------------------------
F6PMP8_BAK1-01      ALNLGNGPILNVLIVLSVVLLG----QFVPTGLGERREKFMIKPNAGSGCRWSPLTSPHP
F6PMP8_BAK1-02      ALNLGNGPILNVLIVLSVVLLG----QFVVRRFFKS------------------------
Q52HB2_BAK1-01      ALNLGNGPILNVLIVLSVVLLG----QFVVRRFFKS------------------------
                                                                                

F1PAN9_BAX-01       --------
Q8HYU5_BAX-01       --------
F6PMP8_BAK1-03      --------
F6PMP8_BAK1-01      LSVSENKL
F6PMP8_BAK1-02      --------
Q52HB2_BAK1-01      --------
                            

© 1998-2020Legal notice