Dataset for protein Bak1 of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F6PMP8_BAK1-03      MASGQGPGPPRRECGEAAPSSTSEEQVARDTEEVFRSYVFYRHRQEQEAEGAAVPADPEM
F6PMP8_BAK1-01      MASGQGPGPPRRECGEAAPSSTSEEQVARDTEEVFRSYVFYRHRQEQEAEGAAVPADPEM
F6PMP8_BAK1-02      MASGQGPGPPRRECGEAAPSSTSEEQVARDTEEVFRSYVFYRHRQ---------------
Q52HB2_BAK1-01      MASGQGPGPPRRECGEAAPSSTSEEQVARDTEEVFRSYVFYRHRQEQEAEGAAVPADPEM
                    *********************************************               

F6PMP8_BAK1-03      VTLPLEPSSTMGQVGRQLAIIGDDINQRYDSEFQAMLQHLQPTAENAYEYFTKIASRPAA
F6PMP8_BAK1-01      VTLPLEPSSTMGQVGRQLAIIGDDINQRYDSEFQAMLQHLQPTAENAYEYFTKIASSLFE
F6PMP8_BAK1-02      -----EPSSTMGQVGRQLAIIGDDINQRYDSEFQAMLQHLQPTAENAYEYFTKIASSLFE
Q52HB2_BAK1-01      VTLPLEPSSTMGQVGRQLAIIGDDINQRYDSEFQAMLQHLQPTAENAYEYFTKIASSLFE
                         ***************************************************    

F6PMP8_BAK1-03      TPTAYLRAAS-----------------TG------------------AEW------WLSW
F6PMP8_BAK1-01      SGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLHHCIARWIAQRGGWVAA
F6PMP8_BAK1-02      SGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLHHCIARWIAQRGGWVAA
Q52HB2_BAK1-01      SGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLHHCIARWIAQRGGWVAA
                    :   : *..:                 **                  * *      *:: 

F6PMP8_BAK1-03      ALATAWPCMSTNAA----------------------------------------------
F6PMP8_BAK1-01      LNLGNGPILNVLIVLSVVLLGQFVPTGLGERREKFMIKPNAGSGCRWSPLTSPHPLSVSE
F6PMP8_BAK1-02      LNLGNGPILNVLIVLSVVLLGQFVVRRFFKS-----------------------------
Q52HB2_BAK1-01      LNLGNGPILNVLIVLSVVLLGQFVVRRFFKS-----------------------------
                          * :..  .                                              

F6PMP8_BAK1-03      ---
F6PMP8_BAK1-01      NKL
F6PMP8_BAK1-02      ---
Q52HB2_BAK1-01      ---
                       

© 1998-2020Legal notice