Dataset for protein Bax of organism Callorhinchus milii

[Download (right click)] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A4W3JNU0_BAX-02      --GFRSRVDG----------------------------------------
A0A4W3JFN9_BAX-01      MKGPRVRESSDSLDATRKLPAITQSCLVVLEVFSWLFKLKSSRGFTIAEF
A0A4W3KFA8_BAX-01      --------------------------------------------------
A0A4W3JNU0_BAX-01      --------------------------------------------------
                                                                         

A0A4W3JNU0_BAX-02      --------------------------------------------------
A0A4W3JFN9_BAX-01      AVTLHRLCGGGCGVGVCGRGSAMESFRASGAADGRLSREEGDRAPDSSDE
A0A4W3KFA8_BAX-01      --------------------------------------------------
A0A4W3JNU0_BAX-01      --------------------------------------------------
                                                                         

A0A4W3JNU0_BAX-02      ------------FIMDRTQRGAEDCEVLVTVSDLGGRADE--LNKPCLKR
A0A4W3JFN9_BAX-01      ILMRQAGGLMRRFVLETIHE--EDPEISLSPDELGGTQSE--IDDPTIKH
A0A4W3KFA8_BAX-01      ------------FIMERLSRSTE--QFGVSLANLGPFPQDTGTAHPHLKG
A0A4W3JNU0_BAX-01      ------------FIMDRTQRGAEDCEVLVTVSDLGGRADE--LNKPCLKR
                                   *:::   .  *  :. ::  :**   .:    .* :* 

A0A4W3JNU0_BAX-02      LGVCLRQIGDELDGNVELQRMINRISTSCPKETFFQVAKELFSDGVINWG
A0A4W3JFN9_BAX-01      VTQCLRTIGDELNRNVELQCLIDSIPINSARDVLCQVAGKLISDE-LNWG
A0A4W3KFA8_BAX-01      MSDSLRRIGDLLSNDTKLQQGIAHMS-DCSKETFFKVAEEVFSDGVVNWG
A0A4W3JNU0_BAX-01      LGVCLRQIGDELDGNVELQRMINRISTSCPKETFFQVAKELFSDGVINWG
                       :  .** *** *. :.:**  *  :. ...::.: :** :::**  :***

A0A4W3JNU0_BAX-02      RVVTLFYFACKFVVKAVCQKLPELIQTIITWTLEYIQENILQWIREHGGW
A0A4W3JFN9_BAX-01      RIVSFFYFAGKLIYKALMQNLRGMIQPIINWSLDFIQNRVVPWIQLQGGW
A0A4W3KFA8_BAX-01      RVVMLFIFACILVLKALTQSIPNIIQTVISWTMEFMQRYVLQWIQNHGGW
A0A4W3JNU0_BAX-01      RVVTLFYFACKFVVKAVCQKLPELIQTIITWTLEYIQENILQWIREHGGW
                       *:* :* **  :: **: *.:  :**.:*.*:::::*. :: **: :***

A0A4W3JNU0_BAX-02      DAI---LGTPTWQTVSIFIL----GVITTLVVVRWKS
A0A4W3JFN9_BAX-01      ENIYSYFGTPTWQMFAVFSA----SIITGVLALMKLT
A0A4W3KFA8_BAX-01      VSD--HLTTTTTNYIAIYAALFTPGQVRTTQGAYILI
A0A4W3JNU0_BAX-01      DAI---LGTPTWQTVSIFIL----GVITTLVVVRWKS
                             : *.* : .:::      . :          

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice